Human CCL13/CKb10/MCP-4 ORF/cDNA clone-Lentivirus particle (NM_005408)

Cat. No.: vGMLP002316

Pre-made Human CCL13/CKb10/MCP-4 Lentiviral expression plasmid for CCL13 lentivirus packaging, CCL13 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to CCL13/CKb10 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP002316 Human CCL13 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP002316
Gene Name CCL13
Accession Number NM_005408
Gene ID 6357
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 297 bp
Gene Alias CKb10,MCP-4,NCC-1,NCC1,SCYA13,SCYL1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAAAGTCTCTGCAGTGCTTCTGTGCCTGCTGCTCATGACAGCAGCTTTCAACCCCCAGGGACTTGCTCAGCCAGATGCACTCAACGTCCCATCTACTTGCTGCTTCACATTTAGCAGTAAGAAGATCTCCTTGCAGAGGCTGAAGAGCTATGTGATCACCACCAGCAGGTGTCCCCAGAAGGCTGTCATCTTCAGAACCAAACTGGGCAAGGAGATCTGTGCTGACCCAAAGGAGAAGTGGGTCCAGAATTATATGAAACACCTGGGCCGGAAAGCTCACACCCTGAAGACTTGA
ORF Protein Sequence MKVSAVLLCLLLMTAAFNPQGLAQPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0739-Ab Anti-CCL13/ CKb10/ MCP-4 functional antibody
    Target Antigen GM-Tg-g-SE0739-Ag CCL13 protein
    Cytokine cks-Tg-g-GM-SE0739 chemokine (C-C motif) ligand 13 (CCL13) protein & antibody
    ORF Viral Vector pGMLP002316 Human CCL13 Lentivirus plasmid
    ORF Viral Vector vGMLP002316 Human CCL13 Lentivirus particle


    Target information

    Target ID GM-SE0739
    Target Name CCL13
    Gene ID 6357, 714907
    Gene Symbol and Synonyms CCL13,CKb10,MCP-4,NCC-1,NCC1,SCYA13,SCYL1
    Uniprot Accession Q99616
    Uniprot Entry Name CCL13_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Cytokine Target
    Disease Breast Cancer
    Gene Ensembl ENSG00000181374
    Target Classification Not Available

    This antimicrobial gene is one of several Cys-Cys (CC) cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for monocytes, lymphocytes, basophils and eosinophils, but not neutrophils. This chemokine plays a role in accumulation of leukocytes during inflammation. It may also be involved in the recruitment of monocytes into the arterial wall during artherosclerosis. [provided by RefSeq, Sep 2014]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.