Human FOLR2/BETA-HFR/FBP ORF/cDNA clone-Lentivirus particle (NM_000803)

Cat. No.: vGMLP001866

Pre-made Human FOLR2/BETA-HFR/FBP Lentiviral expression plasmid for FOLR2 lentivirus packaging, FOLR2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to FOLR2/BETA-HFR products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP001866 Human FOLR2 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP001866
Gene Name FOLR2
Accession Number NM_000803
Gene ID 2350
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 768 bp
Gene Alias BETA-HFR,FBP,FBP/PL-1,FR-BETA,FR-P3
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGTCTGGAAATGGATGCCACTTCTGCTGCTTCTGGTCTGTGTAGCCACCATGTGCAGTGCCCAGGACAGGACTGATCTCCTCAATGTCTGTATGGATGCCAAGCACCACAAGACAAAGCCAGGTCCTGAGGACAAGCTGCATGACCAATGCAGTCCCTGGAAGAAGAATGCCTGCTGCACAGCCAGCACCAGCCAGGAGCTGCACAAGGACACCTCCCGCCTGTACAACTTTAACTGGGACCACTGCGGCAAGATGGAGCCCGCCTGCAAGCGCCACTTCATCCAGGACACCTGTCTCTATGAGTGCTCACCCAACCTGGGGCCCTGGATCCAGCAGGTGAATCAGAGCTGGCGCAAAGAACGCTTCCTGGATGTGCCCTTATGCAAAGAGGACTGTCAGCGCTGGTGGGAGGATTGTCACACCTCCCACACGTGCAAGAGCAACTGGCACAGAGGATGGGACTGGACCTCAGGAGTTAACAAGTGCCCAGCTGGGGCTCTCTGCCGCACCTTTGAGTCCTACTTCCCCACTCCAGCTGCCCTTTGTGAAGGCCTCTGGAGTCACTCATACAAGGTCAGCAACTACAGCCGAGGGAGCGGCCGCTGCATCCAGATGTGGTTTGATTCAGCCCAGGGCAACCCCAACGAGGAAGTGGCGAGGTTCTATGCTGCAGCCATGCATGTGAATGCTGGTGAGATGCTTCATGGGACTGGGGGTCTCCTGCTCAGTCTGGCCCTGATGCTGCAACTCTGGCTCCTTGGCTGA
ORF Protein Sequence MVWKWMPLLLLLVCVATMCSAQDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQSWRKERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSGVNKCPAGALCRTFESYFPTPAALCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMHVNAGEMLHGTGGLLLSLALMLQLWLLG

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T82297-Ab Anti-FOLR2/ BETA-HFR/ FBP monoclonal antibody
    Target Antigen GM-Tg-g-T82297-Ag FOLR2 VLP (virus-like particle)
    ORF Viral Vector pGMLP001866 Human FOLR2 Lentivirus plasmid
    ORF Viral Vector vGMLP001866 Human FOLR2 Lentivirus particle


    Target information

    Target ID GM-T82297
    Target Name FOLR2
    Gene ID 2350, 14276, 718405, 293154, 101095853, 507672, 100066065
    Gene Symbol and Synonyms BETA-HFR,FBP,FBP/PL-1,FBP2,Folbp-2,Folbp2,FOLR1,FOLR2,FR-BETA,FR-P3,FRbeta
    Uniprot Accession P14207
    Uniprot Entry Name FOLR2_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, Immuno-oncology Target
    Disease Not Available
    Gene Ensembl ENSG00000165457
    Target Classification Checkpoint-Immuno Oncology

    The protein encoded by this gene is a member of the folate receptor (FOLR) family, and these genes exist in a cluster on chromosome 11. Members of this gene family have a high affinity for folic acid and for several reduced folic acid derivatives, and they mediate delivery of 5-methyltetrahydrofolate to the interior of cells. This protein has a 68% and 79% sequence homology with the FOLR1 and FOLR3 proteins, respectively. Although this protein was originally thought to be specific to placenta, it can also exist in other tissues, and it may play a role in the transport of methotrexate in synovial macrophages in rheumatoid arthritis patients. Multiple transcript variants that encode the same protein have been found for this gene. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.