Human SDCBP/MDA-9/MDA9 ORF/cDNA clone-Lentivirus particle (NM_005625)
Cat. No.: vGMLP001007
Pre-made Human SDCBP/MDA-9/MDA9 Lentiviral expression plasmid for SDCBP lentivirus packaging, SDCBP lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
SDCBP/MDA-9 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
---|---|---|---|
vGMLP001007 | Human SDCBP Lentivirus particle | Pilot Grade | 1.0E+8TU |
5.0E+8TU | |||
1.0E+9TU | |||
Research Grade | 1.0E+8TU | ||
5.0E+8TU | |||
1.0E+9TU | |||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMLP001007 |
Gene Name | SDCBP |
Accession Number | NM_005625 |
Gene ID | 6386 |
Species | Human |
Product Type | Lentivirus particle (overexpression) |
Insert Length | 897 bp |
Gene Alias | MDA-9,MDA9,ST1,SYCL,TACIP18 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGTCTCTCTATCCATCTCTCGAAGACTTGAAGGTAGACAAAGTAATTCAGGCTCAAACTGCTTTTTCTGCAAACCCTGCCAATCCAGCAATTTTGTCAGAAGCTTCTGCTCCTATCCCTCACGATGGAAATCTCTATCCCAGACTGTATCCAGAGCTCTCTCAATACATGGGGCTGAGTTTAAATGAAGAAGAAATACGTGCAAATGTGGCCGTGGTTTCTGGTGCACCACTTCAGGGGCAGTTGGTAGCAAGACCTTCCAGTATAAACTATATGGTGGCTCCTGTAACTGGTAATGATGTTGGAATTCGTAGAGCAGAAATTAAGCAAGGGATTCGTGAAGTCATTTTGTGTAAGGATCAAGATGGAAAAATTGGACTCAGGCTTAAATCAATAGATAATGGTATATTTGTTCAGCTAGTCCAGGCTAATTCTCCAGCCTCATTGGTTGGTCTGAGATTTGGGGACCAAGTACTTCAGATCAATGGTGAAAACTGTGCAGGATGGAGCTCTGATAAAGCGCACAAGGTGCTCAAACAGGCTTTTGGAGAGAAGATTACCATGACCATTCGTGACAGGCCCTTTGAACGGACGATTACCATGCATAAGGATAGCACTGGACATGTTGGTTTTATCTTTAAAAATGGAAAAATAACATCCATAGTGAAAGATAGCTCTGCAGCCAGAAATGGTCTTCTCACGGAACATAACATCTGTGAAATCAATGGACAGAATGTCATTGGATTGAAGGACTCTCAAATTGCAGACATACTGTCAACATCTGGGACTGTAGTTACTATTACAATCATGCCTGCTTTTATCTTTGAACATATTATTAAGCGGATGGCACCAAGCATTATGAAAAGCCTAATGGACCACACCATTCCTGAGGTTTAA |
ORF Protein Sequence | MSLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAFIFEHIIKRMAPSIMKSLMDHTIPEV |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-MP1494-Ab | Anti-SDCB1/ SDCBP/ MDA-9 monoclonal antibody |
Target Antigen | GM-Tg-g-MP1494-Ag | SDCBP VLP (virus-like particle) |
ORF Viral Vector | pGMLP001007 | Human SDCBP Lentivirus plasmid |
ORF Viral Vector | pGMLP001008 | Human SDCBP Lentivirus plasmid |
ORF Viral Vector | vGMLP001007 | Human SDCBP Lentivirus particle |
ORF Viral Vector | vGMLP001008 | Human SDCBP Lentivirus particle |
Target information
Target ID | GM-MP1494 |
Target Name | SDCBP |
Gene ID | 6386, 53378, 698381, 83841, 101099858, 482977, 510979, 100052836 |
Gene Symbol and Synonyms | MDA-9,MDA9,SDCBP,ST1,SYCL,syntenin-1,TACIP18 |
Uniprot Accession | O00560 |
Uniprot Entry Name | SDCB1_HUMAN |
Protein Sub-location | Transmembrane Protein |
Category | Not Available |
Disease | Renal cell carcinoma |
Gene Ensembl | ENSG00000137575 |
Target Classification | Not Available |
The protein encoded by this gene was initially identified as a molecule linking syndecan-mediated signaling to the cytoskeleton. The syntenin protein contains tandemly repeated PDZ domains that bind the cytoplasmic, C-terminal domains of a variety of transmembrane proteins. This protein may also affect cytoskeletal-membrane organization, cell adhesion, protein trafficking, and the activation of transcription factors. The protein is primarily localized to membrane-associated adherens junctions and focal adhesions but is also found at the endoplasmic reticulum and nucleus. Alternative splicing results in multiple transcript variants encoding different isoforms. Related pseudogenes have been identified on multiple chromosomes. [provided by RefSeq, Jan 2017]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.