Human SLC16A4/MCT4/MCT5 ORF/cDNA clone-Lentivirus particle (NM001201549)
Cat. No.: vGMLP000587
Pre-made Human SLC16A4/MCT4/MCT5 Lentiviral expression plasmid for SLC16A4 lentivirus packaging, SLC16A4 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
SLC16A4/MCT4 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
---|---|---|---|
vGMLP000587 | Human SLC16A4 Lentivirus particle | Pilot Grade | 1.0E+8TU |
5.0E+8TU | |||
1.0E+9TU | |||
Research Grade | 1.0E+8TU | ||
5.0E+8TU | |||
1.0E+9TU | |||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMLP000587 |
Gene Name | SLC16A4 |
Accession Number | NM001201549 |
Gene ID | 9122 |
Species | Human |
Product Type | Lentivirus particle (overexpression) |
Insert Length | 960 bp |
Gene Alias | MCT4,MCT5 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGCTGAAGAGGGAGGGGAAGGTCCAACCTTACACTAAAACCCTGGATGGAGGATGGGGATGGATGATTGTGATTCATTTTTTCCTGGTGAATGTGTTTGTGATGGGGATGACCAAGACTTTTGCAATTTTCTTTGTGGTCTTTCAAGAAGAGTTTGAAGGCACCTCAGAGCAAATTGGTTGGATTGGATCCATCATGTCATCTCTTCGTTTTTGTGCAGGTCCCCTGGTTGCTATTATTTGTGACATACTTGGAGAGAAAACTACCTCCATTCTTGGGGCTTTCGTTGTTACTGGTGGATATCTGATCAGCAGCTGGGCCACAAGTATTCCTTTTCTTTGTGTGACTATGGGACTTCTACCCGGTTTGGGTTCTGCTTTCTTATACCAAGTGGCTGCTGTGGTAACTACCAAATACTTCAAAAAACGATTGGCTCTTTCTACAGCTATTGCCCGTTCTGGGATGGGACTGACTTTTCTTTTGGCACCCTTTACAAAATTCCTGATAGATCTGTATGACTGGACAGGTATCCTTGAGACGGTCAGTCAGATTATTTCTGGATGGGTTGCTGATCAAAACTGGATTAAGAAGTATCATTACCACAAGTCTTACCTCATCCTCTGCGGCATCACTAACCTGCTTGCTCCTTTAGCCACCACATTTCCACTACTTATGACCTACACCATCTGCTTTGCCATCTTTGCTGGTGGTTACCTGGCATTGATACTGCCTGTACTGGTTGATCTGTGTAGGAATTCTACAGTAAACAGGTTTTTGGGACTTGCCAGTTTCTTTGCTGGGATGGCTGTCCTTTCTGGACCACCTATAGCAGGCTGGTTATATGATTATACCCAGACATACAATGGCTCTTTCTACTTCTCTGGCATATGCTATCTCCTCTCTTCAGTTTCCTTTTTTTTTGTACCATTGGCCGAAAGATGGAAAAACAGTCTGACCTGA |
ORF Protein Sequence | MLKREGKVQPYTKTLDGGWGWMIVIHFFLVNVFVMGMTKTFAIFFVVFQEEFEGTSEQIGWIGSIMSSLRFCAGPLVAIICDILGEKTTSILGAFVVTGGYLISSWATSIPFLCVTMGLLPGLGSAFLYQVAAVVTTKYFKKRLALSTAIARSGMGLTFLLAPFTKFLIDLYDWTGILETVSQIISGWVADQNWIKKYHYHKSYLILCGITNLLAPLATTFPLLMTYTICFAIFAGGYLALILPVLVDLCRNSTVNRFLGLASFFAGMAVLSGPPIAGWLYDYTQTYNGSFYFSGICYLLSSVSFFFVPLAERWKNSLT |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-IP1649-Ab | Anti-SLC16A4 monoclonal antibody |
Target Antigen | GM-Tg-g-IP1649-Ag | SLC16A4 protein |
ORF Viral Vector | pGMLP000587 | Human SLC16A4 Lentivirus plasmid |
ORF Viral Vector | pGMLP003146 | Human SLC16A4 Lentivirus plasmid |
ORF Viral Vector | pGMLV000234 | Human SLC16A4 Lentivirus plasmid |
ORF Viral Vector | vGMLP000587 | Human SLC16A4 Lentivirus particle |
ORF Viral Vector | vGMLP003146 | Human SLC16A4 Lentivirus particle |
ORF Viral Vector | vGMLV000234 | Human SLC16A4 Lentivirus particle |
Target information
Target ID | GM-IP1649 |
Target Name | SLC16A4 |
Gene ID | 9122, 229699, 701535, 295356, 101082585, 479908, 525480, 100058580 |
Gene Symbol and Synonyms | MCT 5,MCT4,MCT5,SLC16A4 |
Uniprot Accession | O15374 |
Uniprot Entry Name | MOT5_HUMAN |
Protein Sub-location | Introcelluar Protein |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000168679 |
Target Classification | Not Available |
Predicted to enable monocarboxylic acid transmembrane transporter activity. Predicted to be involved in monocarboxylic acid transport. Predicted to be located in membrane. Predicted to be integral component of plasma membrane. [provided by Alliance of Genome Resources, Apr 2022]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.