Human APOH/B2G1/B2GP1 ORF/cDNA clone-Lentivirus particle (NM_000042)

Cat. No.: vGMLP000456

Pre-made Human APOH/B2G1/B2GP1 Lentiviral expression plasmid for APOH lentivirus packaging, APOH lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to APOH/B2G1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP000456 Human APOH Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP000456
Gene Name APOH
Accession Number NM_000042
Gene ID 350
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 1038 bp
Gene Alias B2G1,B2GP1,BG
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGATTTCTCCAGTGCTCATCTTGTTCTCGAGTTTTCTCTGCCATGTTGCTATTGCAGGACGGACCTGTCCCAAGCCAGATGATTTACCATTTTCCACAGTGGTCCCGTTAAAAACATTCTATGAGCCAGGAGAAGAGATTACGTATTCCTGCAAGCCGGGCTATGTGTCCCGAGGAGGGATGAGAAAGTTTATCTGCCCTCTCACAGGACTGTGGCCCATCAACACTCTGAAATGTACACCCAGAGTATGTCCTTTTGCTGGAATCTTAGAAAATGGAGCCGTACGCTATACGACTTTTGAATATCCCAACACGATCAGTTTTTCTTGTAACACTGGGTTTTATCTGAATGGCGCTGATTCTGCCAAGTGCACTGAGGAAGGAAAATGGAGCCCGGAGCTTCCTGTCTGTGCTCCCATCATCTGCCCTCCACCATCCATACCTACGTTTGCAACACTTCGTGTTTATAAGCCATCAGCTGGAAACAATTCCCTCTATCGGGACACAGCAGTTTTTGAATGTTTGCCACAACATGCGATGTTTGGAAATGATACAATTACCTGCACGACACATGGAAATTGGACTAAATTACCAGAATGCAGGGAAGTAAAATGCCCATTCCCATCAAGACCAGACAATGGATTTGTGAACTATCCTGCAAAACCAACACTTTATTACAAGGATAAAGCCACATTTGGCTGCCATGATGGATATTCTCTGGATGGCCCGGAAGAAATAGAATGTACCAAACTGGGAAACTGGTCTGCCATGCCAAGTTGTAAAGCATCTTGTAAAGTACCTGTGAAAAAAGCCACTGTGGTGTACCAAGGAGAGAGAGTAAAGATTCAGGAAAAATTTAAGAATGGAATGCTACATGGTGATAAAGTTTCTTTCTTCTGCAAAAATAAGGAAAAGAAGTGTAGCTATACAGAGGATGCTCAGTGTATAGATGGCACTATCGAAGTCCCCAAATGCTTCAAGGAACACAGTTCTCTGGCTTTTTGGAAAACTGATGCATCCGATGTAAAGCCATGCTAA
ORF Protein Sequence MISPVLILFSSFLCHVAIAGRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T86885-Ab Anti-APOH/ B2G1/ B2GP1 functional antibody
    Target Antigen GM-Tg-g-T86885-Ag APOH protein
    ORF Viral Vector pGMLP000456 Human APOH Lentivirus plasmid
    ORF Viral Vector pGMAP000271 Human APOH Adenovirus plasmid
    ORF Viral Vector vGMLP000456 Human APOH Lentivirus particle
    ORF Viral Vector vGMAP000271 Human APOH Adenovirus particle


    Target information

    Target ID GM-T86885
    Target Name APOH
    Gene ID 350, 11818, 718645, 287774, 101080593, 403945, 281006, 100063250
    Gene Symbol and Synonyms APOH,B2G1,B2GP1,B2GPI,beta-2-GPI,beta2-GPI,BG
    Uniprot Accession P02749
    Uniprot Entry Name APOH_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000091583
    Target Classification Not Available

    Apolipoprotein H, also known as beta-2-glycoprotein I, is a component of circulating plasma lipoproteins. It has been implicated in a variety of physiologic pathways including lipoprotein metabolism, coagulation, hemostasis, and the production of antiphospholipid autoantibodies. APOH may be a required cofactor for anionic phospholipid binding by the antiphospholipid autoantibodies found in sera of many patients with lupus and primary antiphospholipid syndrome (APS). The anti-beta (2) glycoprotein I antibodies from APS patients, mediate inhibition of activated protein C which has anticoagulant properties. Because beta-2-GPI is the main autoantigen in patients with APS, the disruption of this pathway by autoantibodies may be an important mechanism for thrombosis in patients with APS.[provided by RefSeq, Dec 2019]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.