Human IL17A/CTLA-8/CTLA8 ORF/cDNA clone-Lentivirus particle (NM_002190)

Cat. No.: vGMLP000168

Pre-made Human IL17A/CTLA-8/CTLA8 Lentiviral expression plasmid for IL17A lentivirus packaging, IL17A lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to IL17/IL17A/CTLA-8 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP000168 Human IL17A Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP000168
Gene Name IL17A
Accession Number NM_002190
Gene ID 3605
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 468 bp
Gene Alias CTLA-8,CTLA8,IL-17,IL-17A,IL17
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGACTCCTGGGAAGACCTCATTGGTGTCACTGCTACTGCTGCTGAGCCTGGAGGCCATAGTGAAGGCAGGAATCACAATCCCACGAAATCCAGGATGCCCAAATTCTGAGGACAAGAACTTCCCCCGGACTGTGATGGTCAACCTGAACATCCATAACCGGAATACCAATACCAATCCCAAAAGGTCCTCAGATTACTACAACCGATCCACCTCACCTTGGAATCTCCACCGCAATGAGGACCCTGAGAGATATCCCTCTGTGATCTGGGAGGCAAAGTGCCGCCACTTGGGCTGCATCAACGCTGATGGGAACGTGGACTACCACATGAACTCTGTCCCCATCCAGCAAGAGATCCTGGTCCTGCGCAGGGAGCCTCCACACTGCCCCAACTCCTTCCGGCTGGAGAAGATACTGGTGTCCGTGGGCTGCACCTGTGTCACCCCGATTGTCCACCATGTGGCCTAA
ORF Protein Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-INN-880 Pre-Made Izokibep Biosimilar, Bispecific, Anti-ALB;IL17A/IL17 Antibody: Anti-FDAHT/HSA/PRO0883/PRO0903/PRO1341;CTLA-8/CTLA8A therapeutic antibody
    Biosimilar GMP-Bios-ab-478 Pre-Made Remtolumab biosimilar, Bispecific Dual Variable Domain IG: Anti-IL17A/IL17;TNFA/TNF therapeutic antibody
    Biosimilar GMP-Bios-ab-438 Pre-Made Perakizumab biosimilar, Whole mAb, Anti-IL17A/IL17 Antibody: Anti-CTLA-8/CTLA8A/ILA17 therapeutic antibody
    Biosimilar GMP-Bios-ab-374 Pre-Made Netakimab biosimilar, Whole mAb, Anti-IL17A/IL17 Antibody: Anti-CTLA-8/CTLA8A/ILA17 therapeutic antibody
    Biosimilar GMP-Bios-ab-286 Pre-Made Ixekizumab biosimilar, Whole mAb, Anti-IL17A/IL17 Antibody: Anti-CTLA-8/CTLA8A/ILA17 therapeutic antibody
    Biosimilar GMP-Bios-ab-671 Pre-Made Gumokimab biosimilar, Whole mAb, Anti-IL17A/IL17 Antibody: Anti-CTLA-8/CTLA8A/ILA17 therapeutic antibody
    Biosimilar GMP-Bios-ab-070 Pre-Made Bimekizumab biosimilar, Whole mAb, Anti-IL17A/IL17 Antibody: Anti-CTLA-8/CTLA8A/ILA17 therapeutic antibody
    Biosimilar GMP-Bios-ab-568 Pre-Made Tibulizumab biosimilar, Bispecific Mixed mAb and scFv, Anti-TNFSF13B;IL17A/IL17 Antibody: Anti-BAFF/BLYS/CD257/DTL/TALL-1/TALL1/THANK/TNFSF20/TNLG7A/ZTNF4;CTLA-8/CTLA8A therapeutic antibody
    Biosimilar GMP-Bios-ab-710 Pre-Made Xeligekimab biosimilar, Whole mAb, Anti-IL17A/IL17 Antibody: Anti-CTLA-8/CTLA8A/ILA17 therapeutic antibody
    Biosimilar GMP-Bios-ab-510 Pre-Made Secukinumab biosimilar, Whole mAb, Anti-IL17A/IL17 Antibody: Anti-CTLA-8/CTLA8A/ILA17 therapeutic antibody
    Biosimilar GMP-Bios-ab-012 Pre-Made Afasevikumab biosimilar, Whole mAb, Anti-IL17A/IL17 Antibody: Anti-CTLA-8/CTLA8A/ILA17 therapeutic antibody
    Biosimilar GMP-Bios-ab-633 Pre-Made Vunakizumab biosimilar, Whole mAb, Anti-IL17A/IL17 Antibody: Anti-CTLA-8/CTLA8A/ILA17 therapeutic antibody
    Biosimilar GMP-Bios-INN-996 Pre-Made Sonelokimab Biosimilar, Bispecific, Anti-ALB;IL17A/IL17;IL17F Antibody: Anti-FDAHT/HSA/PRO0883/PRO0903/PRO1341;CTLA-8/CTLA8/IL-17A/ILA17;CANDF6/ML-1/ML1 therapeutic antibody
    Target Antibody GM-Tg-g-T22095-Ab Anti-IL17/ IL17A/ CTLA-8 functional antibody
    Target Antigen GM-Tg-g-T22095-Ag IL17/IL17A protein
    Cytokine cks-Tg-g-GM-T22095 Marmoset interleukin IL17 (IL17A) protein & antibody
    ORF Viral Vector pGMLP000168 Human IL17A Lentivirus plasmid
    ORF Viral Vector pGMLP-IL-020 Human IL17A Lentivirus plasmid
    ORF Viral Vector pGMAP-IL-103 Human IL17A Adenovirus plasmid
    ORF Viral Vector pGMPC004766 Human IL17A Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP000168 Human IL17A Lentivirus particle
    ORF Viral Vector vGMLP-IL-020 Human IL17A Lentivirus particle
    ORF Viral Vector vGMAP-IL-103 Human IL17A Adenovirus particle


    Target information

    Target ID GM-T22095
    Target Name IL17
    Gene ID 3605, 16171, 708123, 301289, 101095339, 481837, 282863, 100034142
    Gene Symbol and Synonyms CTLA-8,CTLA8,IL-17,IL-17A,IL17,IL17A,ILA17
    Uniprot Accession Q16552
    Uniprot Entry Name IL17_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, Immuno-oncology Target, INN Index, Cytokine Target
    Disease Cancer
    Gene Ensembl ENSG00000112115
    Target Classification Checkpoint-Immuno Oncology, Tumor-associated antigen (TAA)

    This gene is a member of the IL-17 receptor family which includes five members (IL-17RA-E) and the encoded protein is a proinflammatory cytokine produced by activated T cells. IL-17A-mediated downstream pathways induce the production of inflammatory molecules, chemokines, antimicrobial peptides, and remodeling proteins. The encoded protein elicits crucial impacts on host defense, cell trafficking, immune modulation, and tissue repair, with a key role in the induction of innate immune defenses. This cytokine stimulates non-hematopoietic cells and promotes chemokine production thereby attracting myeloid cells to inflammatory sites. This cytokine also regulates the activities of NF-kappaB and mitogen-activated protein kinases and can stimulate the expression of IL6 and cyclooxygenase-2 (PTGS2/COX-2), as well as enhance the production of nitric oxide (NO). IL-17A plays a pivotal role in various infectious diseases, inflammatory and autoimmune disorders, and cancer. High levels of this cytokine are associated with several chronic inflammatory diseases including rheumatoid arthritis, psoriasis and multiple sclerosis. The lung damage induced by the severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is to a large extent, a result of the inflammatory response promoted by cytokines such as IL17A. [provided by RefSeq, Sep 2020]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.