Human PRTN3/ACPA/AGP7 ORF/cDNA clone-Adenovirus particle (BC096183)

Cat. No.: vGMAP000488

Pre-made Human PRTN3/ACPA/AGP7 Adenovirus for PRTN3 overexpression in-vitro and in-vivo. The PRTN3 adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified PRTN3-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to PRTN3/ACPA products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAP000488 Human PRTN3 Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAP000488
Gene Name PRTN3
Accession Number BC096183
Gene ID 5657
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 771 bp
Gene Alias ACPA,AGP7,C-ANCA,MBT,P29,PR-3
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence ATGGCTCACCGGCCCCCCAGCCCTGCCCTGGCGTCCGTGCTGCTGGCCTTGCTGCTGAGCGGTGCTGCCCGAGCTGCGGAGATCGTGGGCGGGCACGAGGCGCAGCCACACTCCCGGCCCTACATGGCCTCCCTGCAGATGCGGGGGAACCCGGGCAGCCACTTCTGCGGAGGCACCTTGATCCACCCCAGCTTCGTGCTGACGGCCGCGCACTGCCTGCGGGACATACCCCAGCGCCTGGTGAACGTGGTGCTCGGAGCCCACAACGTGCGGACGCAGGAGCCCACCCAGCAGCACTTCTCGGTGGCTCAGGTGTTTCTGAACAACTACGACGCGGAGAACAAACTGAACGACGTTCTCCTCATCCAGCTGAGCAGCCCAGCCAACCTCAGTGCCTCCGTCGCCACAGTCCAGCTGCCACAGCAGGACCAGCCAGTGCCCCACGGCACCCAGTGCCTGGCCATGGGCTGGGGCCGCGTGGGTGCCCACGACCCCCCAGCCCAGGTCCTGCAGGAGCTCAATGTCACCGTGGTCACCTTCTTCTGCCGGCCACATAACATTTGCACTTTCGTCCCTCGCCGCAAGGCCGGCATCTGCTTCGGAGACTCAGGTGGCCCCCTGATCTGTGATGGCATCATCCAAGGAATAGACTCCTTCGTGATCTGGGGATGTGCCACCCGCCTTTTCCCTGACTTCTTCACGCGGGTAGCCCTCTACGTGGACTGGATCCGTTCCACGCTGCGCCGTGTGGAGGCCAAGGGCCGCCCCTGA
ORF Protein Sequence MAHRPPSPALASVLLALLLSGAARAAEIVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTAAHCLRDIPQRLVNVVLGAHNVRTQEPTQQHFSVAQVFLNNYDAENKLNDVLLIQLSSPANLSASVATVQLPQQDQPVPHGTQCLAMGWGRVGAHDPPAQVLQELNVTVVTFFCRPHNICTFVPRRKAGICFGDSGGPLICDGIIQGIDSFVIWGCATRLFPDFFTRVALYVDWIRSTLRRVEAKGRP

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T15882-Ab Anti-PRTN3/ ACPA/ AGP7 monoclonal antibody
    Target Antigen GM-Tg-g-T15882-Ag PRTN3 VLP (virus-like particle)
    ORF Viral Vector pGMLP000548 Human PRTN3 Lentivirus plasmid
    ORF Viral Vector pGMAP000488 Human PRTN3 Adenovirus plasmid
    ORF Viral Vector vGMLP000548 Human PRTN3 Lentivirus particle
    ORF Viral Vector vGMAP000488 Human PRTN3 Adenovirus particle


    Target information

    Target ID GM-T15882
    Target Name PRTN3
    Gene ID 5657, 19152, 721131, 100298591, 100147215
    Gene Symbol and Synonyms ACPA,AGP7,C-ANCA,CANCA,MBN,MBT,mPR3,NP-4,NP4,P29,PR-3,PR3,PRTN3
    Uniprot Accession P24158
    Uniprot Entry Name PRTN3_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, Immuno-oncology Target
    Disease Cancer
    Gene Ensembl ENSG00000196415
    Target Classification Checkpoint-Immuno Oncology, Tumor-associated antigen (TAA)

    Enables enzyme binding activity; serine-type endopeptidase activity; and signaling receptor binding activity. Involved in several processes, including mature conventional dendritic cell differentiation; membrane protein ectodomain proteolysis; and neutrophil extravasation. Located in azurophil granule lumen; cytosol; and plasma membrane raft. Colocalizes with plasma membrane. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.