Human ERBB3/c-erbB-3/c-erbB3 ORF/cDNA clone-Adenovirus particle (BC002706)

Cat. No.: vGMAP000169

Pre-made Human ERBB3/c-erbB-3/c-erbB3 Adenovirus for ERBB3 overexpression in-vitro and in-vivo. The ERBB3 adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified ERBB3-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to Erbb-3/ERBB3/c-erbB-3 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAP000169 Human ERBB3 Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAP000169
Gene Name ERBB3
Accession Number BC002706
Gene ID 2065
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 996 bp
Gene Alias c-erbB-3,c-erbB3,ErbB-3,erbB3-S,HER3,MDA-BF-1,p180-ErbB3,p45-sErbB3,p85-sErbB3
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Kanamycin
ORF Nucleotide Sequence ATGAGGGCGAACGACGCTCTGCAGGTGCTGGGCTTGCTTTTCAGCCTGGCCCGGGGCTCCGAGGTGGGCAACTCTCAGGCAGTGTGTCCTGGGACTCTGAATGGCCTGAGTGTGACCGGCGATGCTGAGAACCAATACCAGACACTGTACAAGCTCTACGAGAGGTGTGAGGTGGTGATGGGGAACCTTGAGATTGTGCTCACGGGACACAATGCCGACCTCTCCTTCCTGCAGTGGATTCGAGAAGTGACAGGCTATGTCCTCGTGGCCATGAATGAATTCTCTACTCTACCATTGCCCAACCTCCGCGTGGTGCGAGGGACCCAGGTCTACGATGGGAAGTTTGCCATCTTCGTCATGTTGAACTATAACACCAACTCCAGCCACGCTCTGCGCCAGCTCCGCTTGACTCAGCTCACCGAGATTCTGTCAGGGGGTGTTTATATTGAGAAGAACGATAAGCTTTGTCACATGGACACAATTGACTGGAGGGACATCGTGAGGGACCGAGATGCTGAGATAGTGGTGAAGGACAATGGCAGAAGCTGTCCCCCCTGTCATGAGGTTTGCAAGGGGCGATGCTGGGGTCCTGGATCAGAAGACTGCCAGACATTGACCAAGACCATCTGTGCTCCTCAGTGTAATGGTCACTGCTTTGGGCCCAACCCCAACCAGTGCTGCCATGATGAGTGTGCCGGGGGCTGCTCAGGCCCTCAGGACACAGACTGCTTTGCCTGCCGGCACTTCAATGACAGTGGAGCCTGTGTACCTCGCTGTCCACAGCCTCTTGTCTACAACAAGCTAACTTTCCAGCTGGAACCCAATCCCCACACCAAGTATCAGTATGGAGGAGTTTGTGTAGCCAGCTGTCCCCATAACTTTGTGGTGGATCAAACATCCTGTGTCAGGGCCTGTCCTCCTGACAAGATGGAAGTAGATAAAAATGGGCTCAAGATGTGTGAGCCTTGTGGGGGACTATGTCCCAAAGCCTTTTAA
ORF Protein Sequence MRANDALQVLGLLFSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTSCVRACPPDKMEVDKNGLKMCEPCGGLCPKAF

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-INN-946 Pre-Made Patritumab Deruxtecan Biosimilar, Whole Mab Adc, Anti-ERBB3/Erbb-3 Antibody: Anti-ErbB-3/FERLK/HER3/LCCS2/MDA-BF-1/VSCN1/c-erbB-3/c-erbB3/erbB3-S/p180-ErbB3/p45-sErbB3/p85-sErbB3 therapeutic antibody Drug Conjugate
    Biosimilar GMP-Bios-ab-282 Pre-Made Istiratumab biosimilar, Bispecific Mixed mAb and scFv, Anti-IGF1R;ERBB3/Erbb-3 Antibody: Anti-IGFR/CD221/IGFIR/JTK13;FERLK/HER3/LCCS2/MDA-BF-1/VSCN1/c-c-erbB3/p180-ErbB3/p45-sErbB3/p85-sErbB3 therapeutic antibody
    Biosimilar GMP-Bios-ab-431 Pre-Made Patritumab biosimilar, Whole mAb, Anti-ERBB3/Erbb-3 Antibody: Anti-ErbB-3/FERLK/HER3/LCCS2/MDA-BF-1/VSCN1/c-erbB-3/c-erbB3/erbB3-S/p180-ErbB3/p45-sErbB3/p85-sErbB3 therapeutic antibody
    Biosimilar GMP-Bios-ab-048 Pre-Made Barecetamab biosimilar, Whole mAb, Anti-ERBB3/Erbb-3 Antibody: Anti-ErbB-3/FERLK/HER3/LCCS2/MDA-BF-1/VSCN1/c-erbB-3/c-erbB3/erbB3-S/p180-ErbB3/p45-sErbB3/p85-sErbB3 therapeutic antibody
    Biosimilar GMP-Bios-ab-514 Pre-Made Seribantumab biosimilar, Whole mAb, Anti-ERBB3/Erbb-3 Antibody: Anti-ErbB-3/FERLK/HER3/LCCS2/MDA-BF-1/VSCN1/c-erbB-3/c-erbB3/erbB3-S/p180-ErbB3/p45-sErbB3/p85-sErbB3 therapeutic antibody
    Biosimilar GMP-Bios-ab-645 Pre-Made Zenocutuzumab biosimilar, Bispecific mAb, Anti-ERBB3/Erbb-3;ERBB2/HER2 Antibody: Anti-FERLK/HER3/LCCS2/MDA-BF-1/VSCN1/c-erbB3/erbB3-S/p180-ErbB3/p45-sErbB3/p85-sErbB3;CD340/neu/MLN 19/NEU/NGL/TKR1/VSCN2 therapeutic antibody
    Biosimilar GMP-Bios-ab-328 Pre-Made Lumretuzumab biosimilar, Whole mAb, Anti-ERBB3/Erbb-3 Antibody: Anti-ErbB-3/FERLK/HER3/LCCS2/MDA-BF-1/VSCN1/c-erbB-3/c-erbB3/erbB3-S/p180-ErbB3/p45-sErbB3/p85-sErbB3 therapeutic antibody
    Biosimilar GMP-Bios-ab-170 Pre-Made Elgemtumab biosimilar, Whole mAb, Anti-ERBB3/Erbb-3 Antibody: Anti-ErbB-3/FERLK/HER3/LCCS2/MDA-BF-1/VSCN1/c-erbB-3/c-erbB3/erbB3-S/p180-ErbB3/p45-sErbB3/p85-sErbB3 therapeutic antibody
    Biosimilar GMP-Bios-ab-157 Pre-Made Duligotuzumab biosimilar, Whole mAb, Anti-ERBB3/Erbb-3 Antibody: Anti-ErbB-3/FERLK/HER3/LCCS2/MDA-BF-1/VSCN1/c-erbB-3/c-erbB3/erbB3-S/p180-ErbB3/p45-sErbB3/p85-sErbB3 therapeutic antibody
    Target Antibody GM-Tg-g-T86350-Ab Anti-ERBB3/ Erbb-3/ ErbB-3 monoclonal antibody
    Target Antigen GM-Tg-g-T86350-Ag Erbb-3/ERBB3 VLP (virus-like particle)
    Cytokine cks-Tg-g-GM-T86350 erb-b2 receptor tyrosine kinase 3 (ERBB3) protein & antibody
    ORF Viral Vector pGMLP005332 Human ERBB3 Lentivirus plasmid
    ORF Viral Vector pGMAP000169 Human ERBB3 Adenovirus plasmid
    ORF Viral Vector pGMPC000619 Human ERBB3 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP005332 Human ERBB3 Lentivirus particle
    ORF Viral Vector vGMAP000169 Human ERBB3 Adenovirus particle


    Target information

    Target ID GM-T86350
    Target Name Erbb-3
    Gene ID 2065, 13867, 711407, 29496, 101085388, 481105, 785655, 100059216
    Gene Symbol and Synonyms c-erbB-3,c-erbB3,ErbB-3,ERBB3,erbB3-S,Erbb3r,FERLK,HER3,LCCS2,MDA-BF-1,nuc-ErbB3,p180-ErbB3,p45-sErbB3,p85-sErbB3,VSCN1
    Uniprot Accession P21860
    Uniprot Entry Name ERBB3_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, Immuno-oncology Target, INN Index, Cytokine Target
    Disease Non-Small Cell Lung Cancer, Prostate Cancer
    Gene Ensembl ENSG00000065361
    Target Classification Checkpoint-Immuno Oncology, Kinase

    This gene encodes a member of the epidermal growth factor receptor (EGFR) family of receptor tyrosine kinases. This membrane-bound protein has a neuregulin binding domain but not an active kinase domain. It therefore can bind this ligand but not convey the signal into the cell through protein phosphorylation. However, it does form heterodimers with other EGF receptor family members which do have kinase activity. Heterodimerization leads to the activation of pathways which lead to cell proliferation or differentiation. Amplification of this gene and/or overexpression of its protein have been reported in numerous cancers, including prostate, bladder, and breast tumors. Alternate transcriptional splice variants encoding different isoforms have been characterized. One isoform lacks the intermembrane region and is secreted outside the cell. This form acts to modulate the activity of the membrane-bound form. Additional splice variants have also been reported, but they have not been thoroughly characterized. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.