Human FABP3/FABP11/H-FABP ORF/cDNA clone-Adenovirus particle (NM_004102.5)
Cat. No.: vGMAD000969
Pre-made Human FABP3/FABP11/H-FABP Adenovirus for FABP3 overexpression in-vitro and in-vivo. The FABP3 adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified FABP3-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.
At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.
Go to
FABP3/FABP11 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product information
Catalog No. | Product Name | Adenovirus Grade | Adenovirus quantity |
vGMAD000969 | Human FABP3 Adenovirus particle | Research Grade-In vitro | 1E+10PFU (1E+10pfu/ml×1ml) |
5E+10PFU (1E+10pfu/ml×5ml) | |||
1E+11PFU (1E+10pfu/ml×10ml) | |||
Research Grade-In vivo | 1E+11PFU (1E+11pfu/ml×1ml) | ||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMAD000969 |
Gene Name | FABP3 |
Accession Number | NM_004102.5 |
Gene ID | 2170 |
Species | Human |
Product Type | Adenovirus particle (overexpression) |
Insert Length | 402 bp |
Gene Alias | FABP11,H-FABP,M-FABP,MDGI,O-FABP |
Fluorescent Reporter | EGFP |
Mammalian Cell Selection | Null |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | EF1 |
Resistance | Kanamycin |
ORF Nucleotide Sequence | ATGGTGGACGCTTTCCTGGGCACCTGGAAGCTAGTGGACAGCAAGAATTTCGATGACTACATGAAGTCACTCGGTGTGGGTTTTGCTACCAGGCAGGTGGCCAGCATGACCAAGCCTACCACAATCATCGAAAAGAATGGGGACATTCTCACCCTAAAAACACACAGCACCTTCAAGAACACAGAGATCAGCTTTAAGTTGGGGGTGGAGTTCGATGAGACAACAGCAGATGACAGGAAGGTCAAGTCCATTGTGACACTGGATGGAGGGAAACTTGTTCACCTGCAGAAATGGGACGGGCAAGAGACCACACTTGTGCGGGAGCTAATTGATGGAAAACTCATCCTGACACTCACCCACGGCACTGCAGTTTGCACTCGCACTTATGAGAAAGAGGCATGA |
ORF Protein Sequence | MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-IP2483-Ab | Anti-FABP3 monoclonal antibody |
Target Antigen | GM-Tg-g-IP2483-Ag | FABP3 protein |
ORF Viral Vector | pGMLP004884 | Human FABP3 Lentivirus plasmid |
ORF Viral Vector | pGMAD000969 | Human FABP3 Adenovirus plasmid |
ORF Viral Vector | vGMLP004884 | Human FABP3 Lentivirus particle |
ORF Viral Vector | vGMAD000969 | Human FABP3 Adenovirus particle |
Target information
Target ID | GM-IP2483 |
Target Name | FABP3 |
Gene ID | 2170, 14077, 717237, 79131, 101093788, 478156, 281758, 100033895 |
Gene Symbol and Synonyms | FABP,FABP-3,FABP11,FABP3,Fabph-1,Fabph-4,Fabph1,Fabph4,H-FABP,M-FABP,MDGI,O-FABP |
Uniprot Accession | P05413 |
Uniprot Entry Name | FABPH_HUMAN |
Protein Sub-location | Introcelluar Protein |
Category | Diagnostics Biomarker |
Disease | Diabetic Nephropathy, Autosomal Dominant Polycystic Kidney Disease, Proteinuria |
Gene Ensembl | ENSG00000121769 |
Target Classification | Not Available |
The intracellular fatty acid-binding proteins (FABPs) belongs to a multigene family. FABPs are divided into at least three distinct types, namely the hepatic-, intestinal- and cardiac-type. They form 14-15 kDa proteins and are thought to participate in the uptake, intracellular metabolism and/or transport of long-chain fatty acids. They may also be responsible in the modulation of cell growth and proliferation. Fatty acid-binding protein 3 gene contains four exons and its function is to arrest growth of mammary epithelial cells. This gene is a candidate tumor suppressor gene for human breast cancer. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2016]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.