Human FABP3/FABP11/H-FABP ORF/cDNA clone-Adenovirus particle (NM_004102.5)

Cat. No.: vGMAD000969

Pre-made Human FABP3/FABP11/H-FABP Adenovirus for FABP3 overexpression in-vitro and in-vivo. The FABP3 adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified FABP3-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to FABP3/FABP11 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAD000969 Human FABP3 Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAD000969
Gene Name FABP3
Accession Number NM_004102.5
Gene ID 2170
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 402 bp
Gene Alias FABP11,H-FABP,M-FABP,MDGI,O-FABP
Fluorescent Reporter EGFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Kanamycin
ORF Nucleotide Sequence ATGGTGGACGCTTTCCTGGGCACCTGGAAGCTAGTGGACAGCAAGAATTTCGATGACTACATGAAGTCACTCGGTGTGGGTTTTGCTACCAGGCAGGTGGCCAGCATGACCAAGCCTACCACAATCATCGAAAAGAATGGGGACATTCTCACCCTAAAAACACACAGCACCTTCAAGAACACAGAGATCAGCTTTAAGTTGGGGGTGGAGTTCGATGAGACAACAGCAGATGACAGGAAGGTCAAGTCCATTGTGACACTGGATGGAGGGAAACTTGTTCACCTGCAGAAATGGGACGGGCAAGAGACCACACTTGTGCGGGAGCTAATTGATGGAAAACTCATCCTGACACTCACCCACGGCACTGCAGTTTGCACTCGCACTTATGAGAAAGAGGCATGA
ORF Protein Sequence MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2483-Ab Anti-FABP3 monoclonal antibody
    Target Antigen GM-Tg-g-IP2483-Ag FABP3 protein
    ORF Viral Vector pGMLP004884 Human FABP3 Lentivirus plasmid
    ORF Viral Vector pGMAD000969 Human FABP3 Adenovirus plasmid
    ORF Viral Vector vGMLP004884 Human FABP3 Lentivirus particle
    ORF Viral Vector vGMAD000969 Human FABP3 Adenovirus particle


    Target information

    Target ID GM-IP2483
    Target Name FABP3
    Gene ID 2170, 14077, 717237, 79131, 101093788, 478156, 281758, 100033895
    Gene Symbol and Synonyms FABP,FABP-3,FABP11,FABP3,Fabph-1,Fabph-4,Fabph1,Fabph4,H-FABP,M-FABP,MDGI,O-FABP
    Uniprot Accession P05413
    Uniprot Entry Name FABPH_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Diagnostics Biomarker
    Disease Diabetic Nephropathy, Autosomal Dominant Polycystic Kidney Disease, Proteinuria
    Gene Ensembl ENSG00000121769
    Target Classification Not Available

    The intracellular fatty acid-binding proteins (FABPs) belongs to a multigene family. FABPs are divided into at least three distinct types, namely the hepatic-, intestinal- and cardiac-type. They form 14-15 kDa proteins and are thought to participate in the uptake, intracellular metabolism and/or transport of long-chain fatty acids. They may also be responsible in the modulation of cell growth and proliferation. Fatty acid-binding protein 3 gene contains four exons and its function is to arrest growth of mammary epithelial cells. This gene is a candidate tumor suppressor gene for human breast cancer. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2016]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.