Human VEGFA/MVCD1/VEGF ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_001025366.2)

Cat. No.: pGMPC000083
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human VEGFA/MVCD1/VEGF Non-Viral expression plasmid (overexpression vector) for mouse VEGFA overexpression in unique cell transient transfection and stable cell line development.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to VEGFA/MVCD1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMPC000083
Gene Name VEGFA
Accession Number NM_001025366.2
Gene ID 7422
Species Human
Product Type Mammalian (Non-Viral Vector) plasmid (overexpression)
Insert Length 1239 bp
Gene Alias MVCD1,VEGF,VPF
Fluorescent Reporter EGFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence CTGACGGACAGACAGACAGACACCGCCCCCAGCCCCAGCTACCACCTCCTCCCCGGCCGGCGGCGGACAGTGGACGCGGCGGCGAGCCGCGGGCAGGGGCCGGAGCCCGCGCCCGGAGGCGGGGTGGAGGGGGTCGGGGCTCGCGGCGTCGCACTGAAACTTTTCGTCCAACTTCTGGGCTGTTCTCGCTTCGGAGGAGCCGTGGTCCGCGCGGGGGAAGCCGAGCCGAGCGGAGCCGCGAGAAGTGCTAGCTCGGGCCGGGAGGAGCCGCAGCCGGAGGAGGGGGAGGAGGAAGAAGAGAAGGAAGAGGAGAGGGGGCCGCAGTGGCGACTCGGCGCTCGGAAGCCGGGCTCATGGACGGGTGAGGCGGCGGTGTGCGCAGACAGTGCTCCAGCCGCGCGCGCTCCCCAGGCCCTGGCCCGGGCCTCGGGCCGGGGAGGAAGAGTAGCTCGCCGAGGCGCCGAGGAGAGCGGGCCGCCCCACAGCCCGAGCCGGAGAGGGAGCGCGAGCCGCGCCGGCCCCGGTCGGGCCTCCGAAACCATGAACTTTCTGCTGTCTTGGGTGCATTGGAGCCTTGCCTTGCTGCTCTACCTCCACCATGCCAAGTGGTCCCAGGCTGCACCCATGGCAGAAGGAGGAGGGCAGAATCATCACGAAGTGGTGAAGTTCATGGATGTCTATCAGCGCAGCTACTGCCATCCAATCGAGACCCTGGTGGACATCTTCCAGGAGTACCCTGATGAGATCGAGTACATCTTCAAGCCATCCTGTGTGCCCCTGATGCGATGCGGGGGCTGCTGCAATGACGAGGGCCTGGAGTGTGTGCCCACTGAGGAGTCCAACATCACCATGCAGATTATGCGGATCAAACCTCACCAAGGCCAGCACATAGGAGAGATGAGCTTCCTACAGCACAACAAATGTGAATGCAGACCAAAGAAAGATAGAGCAAGACAAGAAAAAAAATCAGTTCGAGGAAAGGGAAAGGGGCAAAAACGAAAGCGCAAGAAATCCCGGTATAAGTCCTGGAGCGTGTACGTTGGTGCCCGCTGCTGTCTAATGCCCTGGAGCCTCCCTGGCCCCCATCCCTGTGGGCCTTGCTCAGAGCGGAGAAAGCATTTGTTTGTACAAGATCCGCAGACGTGTAAATGTTCCTGCAAAAACACAGACTCGCGTTGCAAGGCGAGGCAGCTTGAGTTAAACGAACGTACTTGCAGATGTGACAAGCCGAGGCGGTGA
ORF Protein Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPGPHPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-ab-612 Pre-Made Vanucizumab biosimilar, Bispecific mAb, Anti-ANGPT2;VEGFA Antibody: Anti-AGPT2/ANG2/LMPHM10;VPF/VEGF/MVCD1 therapeutic antibody
    Biosimilar GMP-Bios-INN-757 Pre-Made Bevacizumab Beta Biosimilar, Whole Mab, Anti-Vegfa Antibody: Anti-MVCD1/VEGF/VPF therapeutic antibody
    Biosimilar GMP-Bios-INN-787 Pre-Made Conbercept Biosimilar, Fusion Protein targeting VEGFA fused with human IGHG1 Fc (Fragment constant): Recombinant therapeutic protein targeting MVCD1/VEGF/VPF
    Biosimilar GMP-Bios-INN-813 Pre-Made Efdamrofusp Alfa P Alfaiosimilar, Bispecific, Anti-C3/CO3;C4B;VEGFA Antibody: Anti-AHUS5/ARMD9/ASP/CPAMD1/HEL-S-62p;CH/C4F/CO4/C4BD/C4B12/CPAMD3;VPF/MVCD1 therapeutic antibody
    Biosimilar GMP-Bios-INN-722 Pre-Made Aflibercept Biosimilar, Fusion Protein targeting VEGFA fused with human IGHG1 Fc (Fragment constant): Recombinant therapeutic protein targeting MVCD1/VEGF/VPF
    Biosimilar GMP-Bios-ab-369 Pre-Made Navicixizumab biosimilar, Bispecific mAb, Anti-DLL4;VEGFA Antibody: Anti-AOS6/delta4/hdelta2;VPF/VEGF/MVCD1 therapeutic antibody
    Biosimilar GMP-Bios-ab-145 Pre-Made Dilpacimab biosimilar, Bispecific mAb, Anti-DLL4;VEGFA Antibody: Anti-AOS6/delta4/hdelta2;VPF/VEGF/MVCD1 therapeutic antibody
    Biosimilar GMP-Bios-ab-065 Pre-Made Bevacizumab biosimilar, Whole mAb, Anti-VEGFA Antibody: Anti-VPF/VEGF/MVCD1 therapeutic antibody
    Biosimilar GMP-Bios-INN-1009 Pre-Made Tarcocimab Biosimilar, Whole Mab, Anti-Vegfa Antibody: Anti-MVCD1/VEGF/VPF therapeutic antibody
    Biosimilar GMP-Bios-ab-083 Pre-Made Brolucizumab biosimilar, scFv, Anti-VEGFA Antibody: Anti-VPF/VEGF/MVCD1 therapeutic antibody
    Biosimilar GMP-Bios-ab-470 Pre-Made Ranibizumab biosimilar, Fab, Anti-VEGFA Antibody: Anti-VPF/VEGF/MVCD1 therapeutic antibody
    Biosimilar GMP-Bios-ab-700 Pre-Made Tarcolimab biosimilar, Whole mAb, Anti-VEGFA Antibody: Anti-VPF/VEGF/MVCD1 therapeutic antibody
    Biosimilar GMP-Bios-ab-613 Pre-Made Varisacumab biosimilar, Whole mAb, Anti-VEGFA Antibody: Anti-VPF/VEGF/MVCD1 therapeutic antibody
    Biosimilar GMP-Bios-ab-204 Pre-Made Faricimab biosimilar, Bispecific mAb, Anti-VEGFA;ANGPT2 Antibody: Anti-VPF/VEGF/MVCD1;AGPT2/ANG2/LMPHM10 therapeutic antibody
    Biosimilar GMP-Bios-ab-674 Pre-Made Ivonescimab biosimilar, Whole mAb, Anti-VEGFA Antibody: Anti-VPF/VEGF/MVCD1 therapeutic antibody
    Target Antibody GM-Tg-g-T20761-Ab Anti-VEGFA/ MVCD1/ VEGF functional antibody
    Target Antigen GM-Tg-g-T20761-Ag VEGFA protein
    Cytokine cks-Tg-g-GM-T20761 Vascular endothelial growth factor A (VEGFA) protein & antibody
    ORF Viral Vector pGMLV001934 Human VEGFA Lentivirus plasmid
    ORF Viral Vector pGMAAV000016 Human VEGFA Adeno-associate virus(AAV) plasmid
    ORF Viral Vector pGMAAV000786 Human VEGFA Adeno-associate virus(AAV) plasmid
    ORF Viral Vector pGMPC000083 Human VEGFA Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLV001934 Human VEGFA Lentivirus particle
    ORF Viral Vector vGMAAV000016 Human VEGFA Adeno-associate virus(AAV) particle
    ORF Viral Vector vGMAAV000786 Human VEGFA Adeno-associate virus(AAV) particle


    Target information

    Target ID GM-T20761
    Target Name VEGFA
    Gene ID 7422, 22339, 574209, 83785, 493845, 403802, 281572, 100033839
    Gene Symbol and Synonyms eVEGF120,eVEGF164,MVCD1,VEGF,VEGF-A,VEGF111,VEGF164,VEGFA,VPF
    Uniprot Accession P15692
    Uniprot Entry Name VEGFA_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, Diagnostics Biomarker, Immuno-oncology Target, INN Index, Cytokine Target
    Disease Lung Cancer, Malignant neoplasm of prostate, Chronic Kidney Disease, Malignant neoplasm of bladder, Type 2 diabetes mellitus with diabetic nephropathy, Urinary bladder urothelial carcinoma
    Gene Ensembl ENSG00000112715
    Target Classification Checkpoint-Immuno Oncology

    This gene is a member of the PDGF/VEGF growth factor family. It encodes a heparin-binding protein, which exists as a disulfide-linked homodimer. This growth factor induces proliferation and migration of vascular endothelial cells, and is essential for both physiological and pathological angiogenesis. Disruption of this gene in mice resulted in abnormal embryonic blood vessel formation. This gene is upregulated in many known tumors and its expression is correlated with tumor stage and progression. Elevated levels of this protein are found in patients with POEMS syndrome, also known as Crow-Fukase syndrome. Allelic variants of this gene have been associated with microvascular complications of diabetes 1 (MVCD1) and atherosclerosis. Alternatively spliced transcript variants encoding different isoforms have been described. There is also evidence for alternative translation initiation from upstream non-AUG (CUG) codons resulting in additional isoforms. A recent study showed that a C-terminally extended isoform is produced by use of an alternative in-frame translation termination codon via a stop codon readthrough mechanism, and that this isoform is antiangiogenic. Expression of some isoforms derived from the AUG start codon is regulated by a small upstream open reading frame, which is located within an internal ribosome entry site. The levels of VEGF are increased during infection with severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), thus promoting inflammation by facilitating recruitment of inflammatory cells, and by increasing the level of angiopoietin II (Ang II), one of two products of the SARS-CoV-2 binding target, angiotensin-converting enzyme 2 (ACE2). In turn, Ang II facilitates the elevation of VEGF, thus forming a vicious cycle in the release of inflammatory cytokines. [provided by RefSeq, Jun 2020]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.