Human HILPDA/C7orf68/HIG-2 ORF/cDNA clone-Lentivirus plasmid (NM_013332)

Cat. No.: pGMLV001019
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human HILPDA/C7orf68/HIG-2 Lentiviral expression plasmid for HILPDA lentivirus packaging, HILPDA lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to HILPDA/C7orf68 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLV001019
Gene Name HILPDA
Accession Number NM_013332
Gene ID 29923
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 192 bp
Gene Alias C7orf68,HIG-2,HIG2
Fluorescent Reporter mCherry
Mammalian Cell Selection Neomycin
Fusion Tag Null
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAAGCATGTGTTGAACCTCTACCTGTTAGGTGTGGTACTGACCCTACTCTCCATCTTCGTTAGAGTGATGGAGTCCCTAGAGGGCTTACTAGAGAGCCCATCGCCTGGGACCTCCTGGACCACCAGAAGCCAACTAGCCAACACAGAGCCCACCAAGGGCCTTCCAGACCATCCATCCAGAAGCATGTGA
ORF Protein Sequence MKHVLNLYLLGVVLTLLSIFVRVMESLEGLLESPSPGTSWTTRSQLANTEPTKGLPDHPSRSM

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0263-Ab Anti-HLPDA/ HILPDA/ C7orf68 functional antibody
    Target Antigen GM-Tg-g-SE0263-Ag HILPDA protein
    ORF Viral Vector pGMLP002520 Human HILPDA Lentivirus plasmid
    ORF Viral Vector pGMLV001019 Human HILPDA Lentivirus plasmid
    ORF Viral Vector pGMPC001499 Human HILPDA Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP002520 Human HILPDA Lentivirus particle
    ORF Viral Vector vGMLV001019 Human HILPDA Lentivirus particle


    Target information

    Target ID GM-SE0263
    Target Name HILPDA
    Gene ID 29923, 69573, 701261, 100361568, 101084528, 100688487, 100125928, 102150776
    Gene Symbol and Synonyms 2310016C08Rik,C3H7orf68,C4H7orf68,C7orf68,HIG-2,HIG2,HILPDA
    Uniprot Accession Q9Y5L2
    Uniprot Entry Name HLPDA_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000135245
    Target Classification Not Available

    Enables signaling receptor binding activity. Involved in several processes, including autocrine signaling; cellular response to hypoxia; and positive regulation of lipid storage. Located in several cellular components, including cell surface; lipid droplet; and secretory granule. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.