Human HGF/DFNB39/F-TCF ORF/cDNA clone-Lentivirus plasmid (NM_001010934.2)
Cat. No.: pGMLV000432
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human HGF/DFNB39/F-TCF Lentiviral expression plasmid for HGF lentivirus packaging, HGF lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
HGF/DFNB39 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLV000432 |
Gene Name | HGF |
Accession Number | NM_001010934.2 |
Gene ID | 3082 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 633 bp |
Gene Alias | DFNB39,F-TCF,HGFB,HPTA,SF |
Fluorescent Reporter | mCherry |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | Null |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGTGGGTGACCAAACTCCTGCCAGCCCTGCTGCTGCAGCATGTCCTCCTGCATCTCCTCCTGCTCCCCATCGCCATCCCCTATGCAGAGGGACAAAGGAAAAGAAGAAATACAATTCATGAATTCAAAAAATCAGCAAAGACTACCCTAATCAAAATAGATCCAGCACTGAAGATAAAAACCAAAAAAGTGAATACTGCAGACCAATGTGCTAATAGATGTACTAGGAATAAAGGACTTCCATTCACTTGCAAGGCTTTTGTTTTTGATAAAGCAAGAAAACAATGCCTCTGGTTCCCCTTCAATAGCATGTCAAGTGGAGTGAAAAAAGAATTTGGCCATGAATTTGACCTCTATGAAAACAAAGACTACATTAGAAACTGCATCATTGGTAAAGGACGCAGCTACAAGGGAACAGTATCTATCACTAAGAGTGGCATCAAATGTCAGCCCTGGAGTTCCATGATACCACACGAACACAGCTTTTTGCCTTCGAGCTATCGGGGTAAAGACCTACAGGAAAACTACTGTCGAAATCCTCGAGGGGAAGAAGGGGGACCCTGGTGTTTCACAAGCAATCCAGAGGTACGCTACGAAGTCTGTGACATTCCTCAGTGTTCAGAAGGTAAATAA |
ORF Protein Sequence | MWVTKLLPALLLQHVLLHLLLLPIAIPYAEGQRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEGK |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Biosimilar | GMP-Bios-ab-212 | Pre-Made Ficlatuzumab biosimilar, Whole mAb, Anti-HGF Antibody: Anti-DFNB39/F-TCF/HPTA/SF therapeutic antibody |
Biosimilar | GMP-Bios-ab-483 | Pre-Made Rilotumumab biosimilar, Whole mAb, Anti-HGF Antibody: Anti-DFNB39/F-TCF/HPTA/SF therapeutic antibody |
Target Antibody | GM-Tg-g-T83797-Ab | Anti-HGF/ DFNB39/ F-TCFB functional antibody |
Target Antigen | GM-Tg-g-T83797-Ag | HGF protein |
Cytokine | cks-Tg-g-GM-T83797 | hepatocyte growth factor (HGF) protein & antibody |
ORF Viral Vector | pGMLV000432 | Human HGF Lentivirus plasmid |
ORF Viral Vector | pGMLV000683 | Human HGF Lentivirus plasmid |
ORF Viral Vector | pGMLV001824 | Human HGF Lentivirus plasmid |
ORF Viral Vector | vGMLV000432 | Human HGF Lentivirus particle |
ORF Viral Vector | vGMLV000683 | Human HGF Lentivirus particle |
ORF Viral Vector | vGMLV001824 | Human HGF Lentivirus particle |
Target information
Target ID | GM-T83797 |
Target Name | HGF |
Gene ID | 3082, 15234, 708316, 24446, 493705, 403441, 282879, 100049848 |
Gene Symbol and Synonyms | C230052L06Rik,DFNB39,F-TCF,HGF,HGF/SF,HGFB,HPTA,NK1,NK2,SF,SF/HGF |
Uniprot Accession | P14210 |
Uniprot Entry Name | HGF_HUMAN |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Therapeutics Target, Immuno-oncology Target, INN Index, Cytokine Target |
Disease | Liver Cancer, breast cancer |
Gene Ensembl | ENSG00000019991 |
Target Classification | Checkpoint-Immuno Oncology |
This gene encodes a protein that binds to the hepatocyte growth factor receptor to regulate cell growth, cell motility and morphogenesis in numerous cell and tissue types. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate alpha and beta chains, which form the mature heterodimer. This protein is secreted by mesenchymal cells and acts as a multi-functional cytokine on cells of mainly epithelial origin. This protein also plays a role in angiogenesis, tumorogenesis, and tissue regeneration. Although the encoded protein is a member of the peptidase S1 family of serine proteases, it lacks peptidase activity. Mutations in this gene are associated with nonsyndromic hearing loss. [provided by RefSeq, Nov 2015]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.