Human HGF/DFNB39/F-TCF ORF/cDNA clone-Lentivirus plasmid (NM_001010934.2)

Cat. No.: pGMLV000432
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human HGF/DFNB39/F-TCF Lentiviral expression plasmid for HGF lentivirus packaging, HGF lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to HGF/DFNB39 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $458.25
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLV000432
Gene Name HGF
Accession Number NM_001010934.2
Gene ID 3082
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 633 bp
Gene Alias DFNB39,F-TCF,HGFB,HPTA,SF
Fluorescent Reporter mCherry
Mammalian Cell Selection Puromyocin
Fusion Tag Null
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTGGGTGACCAAACTCCTGCCAGCCCTGCTGCTGCAGCATGTCCTCCTGCATCTCCTCCTGCTCCCCATCGCCATCCCCTATGCAGAGGGACAAAGGAAAAGAAGAAATACAATTCATGAATTCAAAAAATCAGCAAAGACTACCCTAATCAAAATAGATCCAGCACTGAAGATAAAAACCAAAAAAGTGAATACTGCAGACCAATGTGCTAATAGATGTACTAGGAATAAAGGACTTCCATTCACTTGCAAGGCTTTTGTTTTTGATAAAGCAAGAAAACAATGCCTCTGGTTCCCCTTCAATAGCATGTCAAGTGGAGTGAAAAAAGAATTTGGCCATGAATTTGACCTCTATGAAAACAAAGACTACATTAGAAACTGCATCATTGGTAAAGGACGCAGCTACAAGGGAACAGTATCTATCACTAAGAGTGGCATCAAATGTCAGCCCTGGAGTTCCATGATACCACACGAACACAGCTTTTTGCCTTCGAGCTATCGGGGTAAAGACCTACAGGAAAACTACTGTCGAAATCCTCGAGGGGAAGAAGGGGGACCCTGGTGTTTCACAAGCAATCCAGAGGTACGCTACGAAGTCTGTGACATTCCTCAGTGTTCAGAAGGTAAATAA
ORF Protein Sequence MWVTKLLPALLLQHVLLHLLLLPIAIPYAEGQRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEGK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-ab-212 Pre-Made Ficlatuzumab biosimilar, Whole mAb, Anti-HGF Antibody: Anti-DFNB39/F-TCF/HPTA/SF therapeutic antibody
    Biosimilar GMP-Bios-ab-483 Pre-Made Rilotumumab biosimilar, Whole mAb, Anti-HGF Antibody: Anti-DFNB39/F-TCF/HPTA/SF therapeutic antibody
    Target Antibody GM-Tg-g-T83797-Ab Anti-HGF/ DFNB39/ F-TCFB functional antibody
    Target Antigen GM-Tg-g-T83797-Ag HGF protein
    Cytokine cks-Tg-g-GM-T83797 hepatocyte growth factor (HGF) protein & antibody
    ORF Viral Vector pGMLV000432 Human HGF Lentivirus plasmid
    ORF Viral Vector pGMLV000683 Human HGF Lentivirus plasmid
    ORF Viral Vector pGMLV001824 Human HGF Lentivirus plasmid
    ORF Viral Vector vGMLV000432 Human HGF Lentivirus particle
    ORF Viral Vector vGMLV000683 Human HGF Lentivirus particle
    ORF Viral Vector vGMLV001824 Human HGF Lentivirus particle


    Target information

    Target ID GM-T83797
    Target Name HGF
    Gene ID 3082, 15234, 708316, 24446, 493705, 403441, 282879, 100049848
    Gene Symbol and Synonyms C230052L06Rik,DFNB39,F-TCF,HGF,HGF/SF,HGFB,HPTA,NK1,NK2,SF,SF/HGF
    Uniprot Accession P14210
    Uniprot Entry Name HGF_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, Immuno-oncology Target, INN Index, Cytokine Target
    Disease Liver Cancer, breast cancer
    Gene Ensembl ENSG00000019991
    Target Classification Checkpoint-Immuno Oncology

    This gene encodes a protein that binds to the hepatocyte growth factor receptor to regulate cell growth, cell motility and morphogenesis in numerous cell and tissue types. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate alpha and beta chains, which form the mature heterodimer. This protein is secreted by mesenchymal cells and acts as a multi-functional cytokine on cells of mainly epithelial origin. This protein also plays a role in angiogenesis, tumorogenesis, and tissue regeneration. Although the encoded protein is a member of the peptidase S1 family of serine proteases, it lacks peptidase activity. Mutations in this gene are associated with nonsyndromic hearing loss. [provided by RefSeq, Nov 2015]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.