Human PEBP1/HCNP/HCNPpp ORF/cDNA clone-Lentivirus plasmid (NM_002567.3)
Cat. No.: pGMLV000282
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human PEBP1/HCNP/HCNPpp Lentiviral expression plasmid for PEBP1 lentivirus packaging, PEBP1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
PEBP1/HCNP products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLV000282 |
Gene Name | PEBP1 |
Accession Number | NM_002567.3 |
Gene ID | 5037 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 564 bp |
Gene Alias | HCNP,HCNPpp,HEL-210,HEL-S-34,HEL-S-96,PBP,PEBP,PEBP-1,RKIP |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGCCGGTGGACCTCAGCAAGTGGTCCGGGCCCTTGAGCCTGCAAGAAGTGGACGAGCAGCCGCAGCACCCGCTGCATGTCACCTACGCCGGGGCGGCGGTGGACGAGCTGGGCAAAGTGCTGACGCCCACCCAGGTTAAGAATAGACCCACCAGCATTTCGTGGGATGGTCTTGATTCAGGGAAGCTCTACACCTTGGTCCTGACAGACCCGGATGCTCCCAGCAGGAAGGATCCCAAATACAGAGAATGGCATCATTTCCTGGTGGTCAACATGAAGGGCAATGACATCAGCAGTGGCACAGTCCTCTCCGATTATGTGGGCTCGGGGCCTCCCAAGGGCACAGGCCTCCACCGCTATGTCTGGCTGGTTTACGAGCAGGACAGGCCGCTAAAGTGTGACGAGCCCATCCTCAGCAACCGATCTGGAGACCACCGTGGCAAATTCAAGGTGGCGTCCTTCCGTAAAAAGTATGAGCTCAGGGCCCCGGTGGCTGGCACGTGTTACCAGGCCGAGTGGGATGACTATGTGCCCAAACTGTACGAGCAGCTGTCTGGGAAGTAG |
ORF Protein Sequence | MPVDLSKWSGPLSLQEVDEQPQHPLHVTYAGAAVDELGKVLTPTQVKNRPTSISWDGLDSGKLYTLVLTDPDAPSRKDPKYREWHHFLVVNMKGNDISSGTVLSDYVGSGPPKGTGLHRYVWLVYEQDRPLKCDEPILSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGK |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-IP0144-Ab | Anti-PEBP1 monoclonal antibody |
Target Antigen | GM-Tg-g-IP0144-Ag | PEBP1 protein |
ORF Viral Vector | pGMLP005598 | Human PEBP1 Lentivirus plasmid |
ORF Viral Vector | pGMLV000282 | Human PEBP1 Lentivirus plasmid |
ORF Viral Vector | vGMLP005598 | Human PEBP1 Lentivirus particle |
ORF Viral Vector | vGMLV000282 | Human PEBP1 Lentivirus particle |
Target information
Target ID | GM-IP0144 |
Target Name | PEBP1 |
Gene ID | 5037, 23980, 694697, 29542, 101092796, 477501, 431786, 100051008 |
Gene Symbol and Synonyms | HCNP,HCNPpp,HEL-210,HEL-S-34,HEL-S-96,PBP,Pbp1,Pbpr,PEBP,PEBP-1,PEBP1,RKIP |
Uniprot Accession | P30086 |
Uniprot Entry Name | PEBP1_HUMAN |
Protein Sub-location | Introcelluar Protein |
Category | Therapeutics Target |
Disease | Ovary Cancer, Ovarian cancer |
Gene Ensembl | ENSG00000089220 |
Target Classification | Not Available |
This gene encodes a member of the phosphatidylethanolamine-binding family of proteins and has been shown to modulate multiple signaling pathways, including the MAP kinase (MAPK), NF-kappa B, and glycogen synthase kinase-3 (GSK-3) signaling pathways. The encoded protein can be further processed to form a smaller cleavage product, hippocampal cholinergic neurostimulating peptide (HCNP), which may be involved in neural development. This gene has been implicated in numerous human cancers and may act as a metastasis suppressor gene. Multiple pseudogenes of this gene have been identified in the genome. [provided by RefSeq, Jul 2015]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.