Human PBK/CT84/HEL164 ORF/cDNA clone-Lentivirus plasmid (NM_018492.3)

Cat. No.: pGMLP005446
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human PBK/CT84/HEL164 Lentiviral expression plasmid for PBK lentivirus packaging, PBK lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to PBK/CT84 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $542.25
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP005446
Gene Name PBK
Accession Number NM_018492.3
Gene ID 55872
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 969 bp
Gene Alias CT84,HEL164,Nori-3,SPK,TOPK
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGAAGGGATCAGTAATTTCAAGACACCAAGCAAATTATCAGAAAAAAAGAAATCTGTATTATGTTCAACTCCAACTATAAATATCCCGGCCTCTCCGTTTATGCAGAAGCTTGGCTTTGGTACTGGGGTAAATGTGTACCTAATGAAAAGATCTCCAAGAGGTTTGTCTCATTCTCCTTGGGCTGTAAAAAAGATTAATCCTATATGTAATGATCATTATCGAAGTGTGTATCAAAAGAGACTAATGGATGAAGCTAAGATTTTGAAAAGCCTTCATCATCCAAACATTGTTGGTTATCGTGCTTTTACTGAAGCCAATGATGGCAGTCTGTGTCTTGCTATGGAATATGGAGGTGAAAAGTCTCTAAATGACTTAATAGAAGAACGATATAAAGCCAGCCAAGATCCTTTTCCAGCAGCCATAATTTTAAAAGTTGCTTTGAATATGGCAAGAGGGTTAAAGTATCTGCACCAAGAAAAGAAACTGCTTCATGGAGACATAAAGTCTTCAAATGTTGTAATTAAAGGCGATTTTGAAACAATTAAAATCTGTGATGTAGGAGTCTCTCTACCACTGGATGAAAATATGACTGTGACTGACCCTGAGGCTTGTTACATTGGCACAGAGCCATGGAAACCCAAAGAAGCTGTGGAGGAGAATGGTGTTATTACTGACAAGGCAGACATATTTGCCTTTGGCCTTACTTTGTGGGAAATGATGACTTTATCGATTCCACACATTAATCTTTCAAATGATGATGATGATGAAGATAAAACTTTTGATGAAAGTGATTTTGATGATGAAGCATACTATGCAGCGTTGGGAACTAGGCCACCTATTAATATGGAAGAACTGGATGAATCATACCAGAAAGTAATTGAACTCTTCTCTGTATGCACTAATGAAGACCCTAAAGATCGTCCTTCTGCTGCACACATTGTTGAAGCTCTGGAAACAGATGTCTAG
ORF Protein Sequence MEGISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSPWAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGSLCLAMEYGGEKSLNDLIEERYKASQDPFPAAIILKVALNMARGLKYLHQEKKLLHGDIKSSNVVIKGDFETIKICDVGVSLPLDENMTVTDPEACYIGTEPWKPKEAVEENGVITDKADIFAFGLTLWEMMTLSIPHINLSNDDDDEDKTFDESDFDDEAYYAALGTRPPINMEELDESYQKVIELFSVCTNEDPKDRPSAAHIVEALETDV

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T98642-Ab Anti-PBK monoclonal antibody
    Target Antigen GM-Tg-g-T98642-Ag PBK protein
    ORF Viral Vector pGMLP005446 Human PBK Lentivirus plasmid
    ORF Viral Vector pGMLV000097 Human PBK Lentivirus plasmid
    ORF Viral Vector pGMLV002599 Human PBK Lentivirus plasmid
    ORF Viral Vector vGMLP005446 Human PBK Lentivirus particle
    ORF Viral Vector vGMLV000097 Human PBK Lentivirus particle
    ORF Viral Vector vGMLV002599 Human PBK Lentivirus particle


    Target information

    Target ID GM-T98642
    Target Name PBK
    Gene ID 55872, 52033, 713242, 290326, 101080784, 477371, 534781, 100060789
    Gene Symbol and Synonyms 2810434B10Rik,CT84,D14Ertd732e,HEL164,Nori-3,PBK,SPK,TOPK
    Uniprot Accession Q96KB5
    Uniprot Entry Name TOPK_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000168078
    Target Classification Not Available

    This gene encodes a serine/threonine protein kinase related to the dual specific mitogen-activated protein kinase kinase (MAPKK) family. Evidence suggests that mitotic phosphorylation is required for its catalytic activity. The encoded protein may be involved in the activation of lymphoid cells and support testicular functions, with a suggested role in the process of spermatogenesis. Overexpression of this gene has been implicated in tumorigenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.