Human HRH4/AXOR35/BG26 ORF/cDNA clone-Lentivirus plasmid (NM_001160166)

Cat. No.: pGMLP004787
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human HRH4/AXOR35/BG26 Lentiviral expression plasmid for HRH4 lentivirus packaging, HRH4 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to H4R/HRH4/AXOR35 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004787
Gene Name HRH4
Accession Number NM_001160166
Gene ID 59340
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 204 bp
Gene Alias AXOR35,BG26,GPCR105,GPRv53,H4,H4R,HH4R
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCCAGATACTAATAGCACAATCAATTTATCACTAAGCACTCGTGTTACTTTAGCATTTTTTATGTCCTTAGTAGCTTTTGCTATAATGCTAGGAAATGCTTTGGTCATTTTAGCTTTTGTGGTGGACAAAAACCTTAGACATCGAAGTAGTTATTTTTTTCTTAACTTGGCCATCTCTGACTTCTTTGTGGGTGTCTTATAG
ORF Protein Sequence MPDTNSTINLSLSTRVTLAFFMSLVAFAIMLGNALVILAFVVDKNLRHRSSYFFLNLAISDFFVGVL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T26500-Ab Anti-HRH4/ H4R/ AXOR35 monoclonal antibody
    Target Antigen GM-Tg-g-T26500-Ag H4R/HRH4 VLP (virus-like particle)
    ORF Viral Vector pGMLP004787 Human HRH4 Lentivirus plasmid
    ORF Viral Vector vGMLP004787 Human HRH4 Lentivirus particle


    Target information

    Target ID GM-T26500
    Target Name H4R
    Gene ID 59340, 225192, 702044, 170704, 101100602, 490512, 783354, 100034111
    Gene Symbol and Synonyms AXOR35,BG26,GPCR105,GPRv53,H4,H4R,HH4R,HRH4
    Uniprot Accession Q9H3N8
    Uniprot Entry Name HRH4_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000134489
    Target Classification GPCR

    Histamine is a ubiquitous messenger molecule released from mast cells, enterochromaffin-like cells, and neurons. Its various actions are mediated by a family of histamine receptors, which are a subset of the G-protein coupled receptor superfamily. This gene encodes a histamine receptor that is predominantly expressed in haematopoietic cells. The protein is thought to play a role in inflammation and allergy reponses. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2009]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.