Human OSCAR/PIgR-3/PIGR3 ORF/cDNA clone-Lentivirus plasmid (NM_206818)

Cat. No.: pGMLP004773
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human OSCAR/PIgR-3/PIGR3 Lentiviral expression plasmid for OSCAR lentivirus packaging, OSCAR lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to OSCAR/PIgR-3 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $515.25
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004773
Gene Name OSCAR
Accession Number NM_206818
Gene ID 126014
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 861 bp
Gene Alias PIgR-3,PIGR3
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCCCTGGTGCTGATCCTCCAGCTGCTGACCCTCTGGCCTCTGTGTCACACAGACATCACTCCGTCTGTGGCCATTATAGTCCCCCCAGCTTCATACCACCCTAAGCCATGGCTGGGAGCTCAGCCGGCTACAGTTGTGACCCCTGGGGTCAACGTGACCTTGAGATGCCGGGCACCCCAACCCGCTTGGAGATTTGGACTTTTCAAGCCTGGAGAGATCGCTCCCCTTCTCTTCCGGGATGTGTCCTCCGAGCTGGCAGAATTCTTTCTGGAGGAGGTGACTCCAGCCCAAGGGGGAAGTTACCGCTGCTGCTACCGAAGGCCAGACTGGGGGCCGGGTGTCTGGTCCCAGCCCAGCGATGTCCTGGAGCTGCTGGTGACAGAGGAGCTGCCGCGGCCGTCGCTGGTGGCGCTGCCCGGGCCGGTGGTGGGTCCTGGCGCCAACGTGAGCCTGCGCTGCGCGGGCCGCCTGCGGAACATGAGCTTCGTGCTGTACCGCGAGGGCGTGGCGGCCCCGCTGCAGTACCGCCACTCCGCGCAGCCCTGGGCCGACTTCACGCTGCTGGGCGCCCGCGCCCCCGGCACCTACAGCTGCTACTATCACACGCCCTCCGCGCCCTACGTGCTGTCGCAGCGCAGCGAGGTGCTGGTCATCAGCTGGGAAGGTGAGGGCCCTGAGGCCCGGCCCGCCTCCTCCGCCCCAGGAATGCAGGCCCCAGGACCTCCGCCCTCAGACCCAGGAGCCCAGGCCCCCAGCCTCTCCTCCTTCAGACCCAGGGGTCTAGTCCTGCAGCCCCTCCTCCCTCAGACCCAGGATTCCTGGGACCCAGCCCCTCCTCCCTCAGATCCAGGAGTCTAG
ORF Protein Sequence MALVLILQLLTLWPLCHTDITPSVAIIVPPASYHPKPWLGAQPATVVTPGVNVTLRCRAPQPAWRFGLFKPGEIAPLLFRDVSSELAEFFLEEVTPAQGGSYRCCYRRPDWGPGVWSQPSDVLELLVTEELPRPSLVALPGPVVGPGANVSLRCAGRLRNMSFVLYREGVAAPLQYRHSAQPWADFTLLGARAPGTYSCYYHTPSAPYVLSQRSEVLVISWEGEGPEARPASSAPGMQAPGPPPSDPGAQAPSLSSFRPRGLVLQPLLPQTQDSWDPAPPPSDPGV

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T81903-Ab Anti-OSCAR/ PIGR3/ PIgR-3 monoclonal antibody
    Target Antigen GM-Tg-g-T81903-Ag OSCAR VLP (virus-like particle)
    ORF Viral Vector pGMLP004773 Human OSCAR Lentivirus plasmid
    ORF Viral Vector vGMLP004773 Human OSCAR Lentivirus particle


    Target information

    Target ID GM-T81903
    Target Name OSCAR
    Gene ID 126014, 232790, 106994857, 292537, 105261216, 484313, 100336423, 100051988
    Gene Symbol and Synonyms mOSCAR,mOSCAR-M1,mOSCAR-M2,mOSCAR-M3,OSCAR,PIgR-3,PIGR3,RGD1559897
    Uniprot Accession Q8IYS5
    Uniprot Entry Name OSCAR_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000170909
    Target Classification Not Available

    Osteoclasts are multinucleated cells that resorb bone and are essential for bone homeostasis. This gene encodes an osteoclast-associated receptor (OSCAR), which is a member of the leukocyte receptor complex protein family that plays critical roles in the regulation of both innate and adaptive immune responses. The encoded protein may play a role in oxidative stress-mediated atherogenesis as well as monocyte adhesion. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2013]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.