Human AMELY/AMGL/AMGY ORF/cDNA clone-Lentivirus plasmid (NM_001143)

Cat. No.: pGMLP004757
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human AMELY/AMGL/AMGY Lentiviral expression plasmid for AMELY lentivirus packaging, AMELY lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to AMELY/AMGL products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $444.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004757
Gene Name AMELY
Accession Number NM_001143
Gene ID 266
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 579 bp
Gene Alias AMGL,AMGY
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGGACCTGGATTTTGTTTGCCTGCCTTGTGGGAGCAGCTTTTGCCATGCCTCTACCACCTCATCCTGGGCACCCTGGTTATATCAACTTCAGCTATGAGGTGCTCACCCCTTTGAAGTGGTACCAGAGCATGATAAGACCACCATACTCTTCCTATGGTTACGAGCCCATGGGTGGATGGCTGCACCACCAAATCATCCCCGTGGTGTCCCAACAGCACCCCCTGACTCACACCCTGCAGTCTCATCACCACATCCCAGTGGTGCCAGCTCAGCAGCCCAGGGTCCGCCAGCAAGCACTGATGCCTGTTCCTGGCCAGCAATCCATGACTCCAACCCAACACCATCAGCCAAACCTCCCTCTGCCTGCCCAGCAGCCCTTCCAGCCCCAGCCTGTTCAGCCACAGCCTCACCAGCCCATGCAGCCCCAGCCACCTGTGCAACCCATGCAGCCCCTGCTGCCACAGCCACCTCTGCCTCCAATGTTCCCCCTGCGGCCCCTGCCCCCCATACTTCCTGATCTGCATCTGGAAGCTTGGCCAGCAACAGACAAGACCAAGCAGGAGGAAGTGGATTAA
ORF Protein Sequence MGTWILFACLVGAAFAMPLPPHPGHPGYINFSYEVLTPLKWYQSMIRPPYSSYGYEPMGGWLHHQIIPVVSQQHPLTHTLQSHHHIPVVPAQQPRVRQQALMPVPGQQSMTPTQHHQPNLPLPAQQPFQPQPVQPQPHQPMQPQPPVQPMQPLLPQPPLPPMFPLRPLPPILPDLHLEAWPATDKTKQEEVD

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0659-Ab Anti-AMELY/ AMGL/ AMGY functional antibody
    Target Antigen GM-Tg-g-SE0659-Ag AMELY protein
    ORF Viral Vector pGMLP004757 Human AMELY Lentivirus plasmid
    ORF Viral Vector vGMLP004757 Human AMELY Lentivirus particle


    Target information

    Target ID GM-SE0659
    Target Name AMELY
    Gene ID 266
    Gene Symbol and Synonyms AMELY,AMGL,AMGY
    Uniprot Accession Q99218
    Uniprot Entry Name AMELY_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000099721
    Target Classification Not Available

    This gene encodes a member of the amelogenin family of extracellular matrix proteins. Amelogenins are involved in biomineralization during tooth enamel development. Mutations in a related gene on chromosome X cause X-linked amelogenesis imperfecta. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.