Human FCER1G/FCRG ORF/cDNA clone-Lentivirus plasmid (NM_004106)

Cat. No.: pGMLP004456
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human FCER1G/FCRG Lentiviral expression plasmid for FCER1G lentivirus packaging, FCER1G lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to FCERG/FCER1G/FCRG products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004456
Gene Name FCER1G
Accession Number NM_004106
Gene ID 2207
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 261 bp
Gene Alias FCRG
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGATTCCAGCAGTGGTCTTGCTCTTACTCCTTTTGGTTGAACAAGCAGCGGCCCTGGGAGAGCCTCAGCTCTGCTATATCCTGGATGCCATCCTGTTTCTGTATGGAATTGTCCTCACCCTCCTCTACTGTCGACTGAAGATCCAAGTGCGAAAGGCAGCTATAACCAGCTATGAGAAATCAGATGGTGTTTACACGGGCCTGAGCACCAGGAACCAGGAGACTTACGAGACTCTGAAGCATGAGAAACCACCACAGTAG
ORF Protein Sequence MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T95400-Ab Anti-FCERG/ FCER1G/ FCRG monoclonal antibody
    Target Antigen GM-Tg-g-T95400-Ag FCERG/FCER1G VLP (virus-like particle)
    ORF Viral Vector pGMLP004456 Human FCER1G Lentivirus plasmid
    ORF Viral Vector pGMAD000910 Human FCER1G Adenovirus plasmid
    ORF Viral Vector vGMLP004456 Human FCER1G Lentivirus particle
    ORF Viral Vector vGMAD000910 Human FCER1G Adenovirus particle


    Target information

    Target ID GM-T95400
    Target Name FCERG
    Gene ID 2207, 14127, 720291, 25441, 101089236, 403798, 282226, 100034137
    Gene Symbol and Synonyms CD23,Fce1g,FcepsilonRI,FCER1G,FcR-gamma,FCRG,FcRgamma,FcR[g],Ly-50
    Uniprot Accession P30273
    Uniprot Entry Name FCERG_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000158869
    Target Classification Not Available

    The high affinity IgE receptor is a key molecule involved in allergic reactions. It is a tetramer composed of 1 alpha, 1 beta, and 2 gamma chains. The gamma chains are also subunits of other Fc receptors. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.