Human FAM19A4/TAFA-4/TAFA4 ORF/cDNA clone-Lentivirus plasmid (NM_182522)
Cat. No.: pGMLP004273
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human FAM19A4/TAFA-4/TAFA4 Lentiviral expression plasmid for FAM19A4 lentivirus packaging, FAM19A4 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
FAM19A4/TAFA-4 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP004273 |
Gene Name | FAM19A4 |
Accession Number | NM_182522 |
Gene ID | 151647 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 423 bp |
Gene Alias | TAFA-4,TAFA4 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGAGGTCCCCAAGGATGAGAGTCTGTGCTAAGTCAGTGTTGCTGTCGCACTGGCTCTTTCTAGCCTACGTGTTAATGGTGTGCTGTAAGCTGATGTCCGCCTCAAGCCAGCACCTCCGGGGACATGCAGGTCACCACCAAATCAAGCAAGGGACCTGTGAGGTGGTCGCCGTGCACAGGTGCTGCAATAAGAACCGCATAGAAGAGCGGTCACAAACGGTCAAGTGCTCTTGCTTCCCGGGACAGGTGGCGGGCACAACTCGGGCTCAACCTTCTTGTGTTGAAGCTTCCATTGTGATTCAGAAATGGTGGTGTCACATGAATCCGTGTTTGGAAGGAGAGGATTGTAAAGTGCTGCCAGATTACTCAGGTTGGTCCTGTAGCAGTGGCAATAAAGTCAAAACTACGAAGGTAACGCGGTAG |
ORF Protein Sequence | MRSPRMRVCAKSVLLSHWLFLAYVLMVCCKLMSASSQHLRGHAGHHQIKQGTCEVVAVHRCCNKNRIEERSQTVKCSCFPGQVAGTTRAQPSCVEASIVIQKWWCHMNPCLEGEDCKVLPDYSGWSCSSGNKVKTTKVTR |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-SE0196-Ab | Anti-TAFA4/ FAM19A4/ TAFA-4 functional antibody |
Target Antigen | GM-Tg-g-SE0196-Ag | FAM19A4 protein |
Cytokine | cks-Tg-g-GM-SE0196 | family with sequence similarity 19 (chemokine (C-C motif)-like), member A4 (FAM19A4) protein & antibody |
ORF Viral Vector | pGMLP004273 | Human FAM19A4 Lentivirus plasmid |
ORF Viral Vector | vGMLP004273 | Human FAM19A4 Lentivirus particle |
Target information
Target ID | GM-SE0196 |
Target Name | FAM19A4 |
Gene ID | 151647, 320701, 696987, 689043, 101089425, 610997, 616873, 100629222 |
Gene Symbol and Synonyms | C130034I18Rik,FAM19A4,Fam19a4 Tafa-4,TAFA-4,TAFA4 |
Uniprot Accession | Q96LR4 |
Uniprot Entry Name | TAFA4_HUMAN |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Cytokine Target |
Disease | Not Available |
Gene Ensembl | ENSG00000163377 |
Target Classification | Not Available |
This gene is a member of the TAFA family which is composed of five highly homologous genes that encode small secreted proteins. These proteins contain conserved cysteine residues at fixed positions, and are distantly related to MIP-1alpha, a member of the CC-chemokine family. The TAFA proteins are predominantly expressed in specific regions of the brain, and are postulated to function as brain-specific chemokines or neurokines, that act as regulators of immune and nervous cells. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Nov 2011]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.