Human PRRT2/FLJ25513 ORF/cDNA clone-Lentivirus plasmid (BC011405)

Cat. No.: pGMLP004065
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human PRRT2/FLJ25513 Lentiviral expression plasmid for PRRT2 lentivirus packaging, PRRT2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to PRRT2/FLJ25513 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $586.44
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004065
Gene Name PRRT2
Accession Number BC011405
Gene ID 112476
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 1023 bp
Gene Alias FLJ25513
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCAGCCAGCAGCTCTGAGATCTCTGAGATGAAGGGGGTTGAGGAGAGTCCCAAGGTTCCAGGCGAAGGGCCTGGCCATTCTGAAGCTGAAACTGGCCCTCCCCAGGTCCTAGCAGGGGTACCAGACCAGCCAGAGGCCCCGCAGCCAGGTCCAAACACCACTGCGGCCCCTGTGGACTCAGGGCCCAAGGCTGGGCTGGCTCCAGAAACCACAGAGACCCCGGCTGGGGCCTCAGAAACAGCCCAGGCCACAGACCTCAGCTTAAGCCCAGGAGGGGAATCAAAGGCCAACTGCAGCCCCGAAGACCCATGCCAAGAAACAGTGTCCAAACCAGAAGTGAGCAAAGAGGCCACTGCAGACCAGGGGTCCAGGCTGGAGTCTGCAGCCCCACCTGAACCAGCCCCAGAGCCTGCTCCCCAACCAGACCCCCGGCCAGATTCCCAGCCTTCCCCCAAGCCAGCCCTTCAACCAGAGCTCCCTACCCAGGAGGACCCCACCCCTGAGATTCTGTCTGAGAGTGTAGGGGAAAAGCAAGAGAATGGGGCAGTGGTGCCCCTGCAGGCTGGTGATGGGGAAGAGGGCCCAGCCCCTGAGCCTCACTCACCACCCTCAAAAAAATCCCCCCCAGCCAATGGGGCCCCCCCCCGAGTGCTGCAGCAGCTGGTTGAGGAGGATCGAATGAGAAGGGCACACAGTGGGCATCCAGGATCTCCCCGAGGTAGCCTGAGCCGCCACCCCAGCTCCCAGCTGGCAGGTCCTGGGGTGGAGGGGGGTGAAGGCACCCAGAAACCTCGGGACTACATCATCCTTGCCATCCTGTCCTGCTTCTGCCCCATGTGGCCTGTCAACATCGTGGCCTTCGCTTATGCTGTCATGTCCCGGAACAGCCTGCAGCAGGGGGACGTGGACGGGGCCCAGCGTCTGGGCCGGGTAGCCAAGCTCTTAAGCATCGTGGCGCTGGTGGGGGGAGTCCTCATCATCATCGCCTCCTGCGTCATCAACTTAGGCGTGTATAAGTGA
ORF Protein Sequence MAASSSEISEMKGVEESPKVPGEGPGHSEAETGPPQVLAGVPDQPEAPQPGPNTTAAPVDSGPKAGLAPETTETPAGASETAQATDLSLSPGGESKANCSPEDPCQETVSKPEVSKEATADQGSRLESAAPPEPAPEPAPQPDPRPDSQPSPKPALQPELPTQEDPTPEILSESVGEKQENGAVVPLQAGDGEEGPAPEPHSPPSKKSPPANGAPPRVLQQLVEEDRMRRAHSGHPGSPRGSLSRHPSSQLAGPGVEGGEGTQKPRDYIILAILSCFCPMWPVNIVAFAYAVMSRNSLQQGDVDGAQRLGRVAKLLSIVALVGGVLIIIASCVINLGVYK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP1413-Ab Anti-PRRT2/ BFIC2/ BFIS2 monoclonal antibody
    Target Antigen GM-Tg-g-MP1413-Ag PRRT2 VLP (virus-like particle)
    ORF Viral Vector pGMLP004065 Human PRRT2 Lentivirus plasmid
    ORF Viral Vector pGMLP-SPh-064 Human PRRT2 Lentivirus plasmid
    ORF Viral Vector pGMAP-SPh-204 Human PRRT2 Adenovirus plasmid
    ORF Viral Vector vGMLP004065 Human PRRT2 Lentivirus particle
    ORF Viral Vector vGMLP-SPh-064 Human PRRT2 Lentivirus particle
    ORF Viral Vector vGMAP-SPh-204 Human PRRT2 Adenovirus particle


    Target information

    Target ID GM-MP1413
    Target Name PRRT2
    Gene ID 112476, 69017, 709072, 361651, 101096627, 100686783, 112444325, 100065869
    Gene Symbol and Synonyms 1500031I19Rik,BFIC2,BFIS2,DSPB3,DYT10,EKD1,FICCA,ICCA,IFITMD1,PKC,PRRT2,RGD1564195
    Uniprot Accession Q7Z6L0
    Uniprot Entry Name PRRT2_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000167371
    Target Classification Not Available

    This gene encodes a transmembrane protein containing a proline-rich domain in its N-terminal half. Studies in mice suggest that it is predominantly expressed in brain and spinal cord in embryonic and postnatal stages. Mutations in this gene are associated with episodic kinesigenic dyskinesia-1. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2012]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.