Human DEFA6/DEF6/HD-6 ORF/cDNA clone-Lentivirus plasmid (NM_001926)

Cat. No.: pGMLP003850
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human DEFA6/DEF6/HD-6 Lentiviral expression plasmid for DEFA6 lentivirus packaging, DEFA6 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to DEFA6/DEF6 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003850
Gene Name DEFA6
Accession Number NM_001926
Gene ID 1671
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 303 bp
Gene Alias DEF6,HD-6
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAGAACCCTCACCATCCTCACTGCTGTTCTCCTCGTGGCCCTCCAGGCCAAGGCTGAGCCACTCCAAGCTGAGGATGATCCACTGCAGGCAAAAGCTTATGAGGCTGATGCCCAGGAGCAGCGTGGGGCAAATGACCAGGACTTTGCCGTCTCCTTTGCAGAGGATGCAAGCTCAAGTCTTAGAGCTTTGGGCTCAACAAGGGCTTTCACTTGCCATTGCAGAAGGTCCTGTTATTCAACAGAATATTCCTATGGGACCTGCACTGTCATGGGTATTAACCACAGATTCTGCTGCCTCTGA
ORF Protein Sequence MRTLTILTAVLLVALQAKAEPLQAEDDPLQAKAYEADAQEQRGANDQDFAVSFAEDASSSLRALGSTRAFTCHCRRSCYSTEYSYGTCTVMGINHRFCCL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0854-Ab Anti-DEF6/ DEFA6/ HD-6 functional antibody
    Target Antigen GM-Tg-g-SE0854-Ag DEFA6 protein
    ORF Viral Vector pGMLP003850 Human DEFA6 Lentivirus plasmid
    ORF Viral Vector vGMLP003850 Human DEFA6 Lentivirus particle


    Target information

    Target ID GM-SE0854
    Target Name DEFA6
    Gene ID 1671, 13240, 717000
    Gene Symbol and Synonyms DEF6,DEFA6,Defcr6,HD-6
    Uniprot Accession Q01524
    Uniprot Entry Name DEF6_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000164822
    Target Classification Not Available

    Defensins are a family of antimicrobial and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif. Several alpha defensin genes appear to be clustered on chromosome 8. The protein encoded by this gene, defensin, alpha 6, is highly expressed in the secretory granules of Paneth cells of the small intestine, and likely plays a role in host defense of human bowel. [provided by RefSeq, Oct 2014]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.