Human TMEM167A/TMEM167 ORF/cDNA clone-Lentivirus plasmid (NM_174909)

Cat. No.: pGMLP003797
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human TMEM167A/TMEM167 Lentiviral expression plasmid for TMEM167A lentivirus packaging, TMEM167A lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to TMEM167A/TMEM167 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003797
Gene Name TMEM167A
Accession Number NM_174909
Gene ID 153339
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 219 bp
Gene Alias TMEM167
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTCTGCCATTTTCAATTTTCAGAGTCTATTGACTGTAATCTTGCTGCTTATATGTACCTGTGCTTATATTCGATCCTTGGCACCCAGCCTCCTGGACAGAAATAAAACTGGATTGTTGGGTATATTTTGGAAGTGTGCCAGAATTGGTGAACGGAAGAGTCCTTATGTTGCAGTATGCTGTATAGTAATGGCCTTCAGCATCCTCTTCATACAGTAG
ORF Protein Sequence MSAIFNFQSLLTVILLLICTCAYIRSLAPSLLDRNKTGLLGIFWKCARIGERKSPYVAVCCIVMAFSILFIQ

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2005-Ab Anti-TMEM167A monoclonal antibody
    Target Antigen GM-Tg-g-IP2005-Ag TMEM167A protein
    ORF Viral Vector pGMLP003797 Human TMEM167A Lentivirus plasmid
    ORF Viral Vector vGMLP003797 Human TMEM167A Lentivirus particle


    Target information

    Target ID GM-IP2005
    Target Name TMEM167A
    Gene ID 153339, 66074, 712218, 100359823, 101092661, 610083, 613669, 100629746
    Gene Symbol and Synonyms 0610041E09Rik,5730424F14Rik,Gm10085,kish,TMEM167,TMEM167A
    Uniprot Accession Q8TBQ9
    Uniprot Entry Name KISHA_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000174695
    Target Classification Not Available

    Involved in constitutive secretory pathway. Located in Golgi apparatus. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.