Human PERP/dJ496H19.1/KCP1 ORF/cDNA clone-Lentivirus plasmid (NM_022121)

Cat. No.: pGMLP003774
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human PERP/dJ496H19.1/KCP1 Lentiviral expression plasmid for PERP lentivirus packaging, PERP lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to PERP/dJ496H19.1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $445.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003774
Gene Name PERP
Accession Number NM_022121
Gene ID 64065
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 582 bp
Gene Alias dJ496H19.1,KCP1,KRTCAP1,PIGPC1,THW
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGATCCGCTGCGGCCTGGCCTGCGAGCGCTGCCGCTGGATCCTGCCCCTGCTCCTACTCAGCGCCATCGCCTTCGACATCATCGCGCTGGCCGGCCGCGGCTGGTTGCAGTCTAGCGACCACGGCCAGACGTCCTCGCTGTGGTGGAAATGCTCCCAAGAGGGCGGCGGCAGCGGGTCCTACGAGGAGGGCTGTCAGAGCCTCATGGAGTACGCGTGGGGTAGAGCAGCGGCTGCCATGCTCTTCTGTGGCTTCATCATCCTGGTGATCTGTTTCATCCTCTCCTTCTTCGCCCTCTGTGGACCCCAGATGCTTGTCTTCCTGAGAGTGATTGGAGGTCTCCTTGCCTTGGCTGCTGTGTTCCAGATCATCTCCCTGGTAATTTACCCCGTGAAGTACACCCAGACCTTCACCCTTCATGCCAACCCTGCTGTCACTTACATCTATAACTGGGCCTACGGCTTTGGGTGGGCAGCCACGATTATCCTGATTGGCTGTGCCTTCTTCTTCTGCTGCCTCCCCAACTACGAAGATGACCTTCTGGGCAATGCCAAGCCCAGGTACTTCTACACATCTGCCTAA
ORF Protein Sequence MIRCGLACERCRWILPLLLLSAIAFDIIALAGRGWLQSSDHGQTSSLWWKCSQEGGGSGSYEEGCQSLMEYAWGRAAAAMLFCGFIILVICFILSFFALCGPQMLVFLRVIGGLLALAAVFQIISLVIYPVKYTQTFTLHANPAVTYIYNWAYGFGWAATIILIGCAFFFCCLPNYEDDLLGNAKPRYFYTSA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP1360-Ab Anti-PERP/ KCP1/ KRTCAP1 monoclonal antibody
    Target Antigen GM-Tg-g-MP1360-Ag PERP VLP (virus-like particle)
    ORF Viral Vector pGMLP003774 Human PERP Lentivirus plasmid
    ORF Viral Vector vGMLP003774 Human PERP Lentivirus particle


    Target information

    Target ID GM-MP1360
    Target Name PERP
    Gene ID 64065, 64058, 703890, 292949, 101083938, 476218, 509485, 100067837
    Gene Symbol and Synonyms 1110017A08Rik,dJ496H19.1,EKVP7,KCP1,KRTCAP1,OLMS2,PERP,PIGPC1,THW
    Uniprot Accession Q96FX8
    Uniprot Entry Name PERP_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Prostate Cancer
    Gene Ensembl ENSG00000112378
    Target Classification Not Available

    Involved in activation of cysteine-type endopeptidase activity. Predicted to be located in plasma membrane. Predicted to be active in cell-cell junction. Implicated in erythrokeratodermia variabilis and mutilating palmoplantar keratoderma with periorificial keratotic plaques. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.