Human GATD3A/C21orf33/ES1 ORF/cDNA clone-Lentivirus plasmid (NM_004649)

Cat. No.: pGMLP003494
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human GATD3A/C21orf33/ES1 Lentiviral expression plasmid for GATD3A lentivirus packaging, GATD3A lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to GATD3A/C21orf33 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $501.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003494
Gene Name GATD3A
Accession Number NM_004649
Gene ID 8209
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 807 bp
Gene Alias C21orf33,ES1,GATD3,GT335,HES1,KNPH,KNPI
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGGCTGTGAGGGTCCTGGTGGCCTCGAGGCTCGCTGCGGCATCTGCATTCACGTCCCTGTCCCCCGGCGGTCGGACGCCTTCCCAGCGCGCAGCCCTTCACCTCTCCGTGCCGCGCCCCGCGGCCAGGGTCGCGCTGGTGCTGTCTGGATGCGGAGTCTACGATGGGACCGAGATCCACGAGGCCTCGGCGATCCTGGTGCACCTGAGCCGTGGAGGGGCTGAAGTCCAGATCTTTGCTCCTGACGTCCCTCAGATGCACGTGATTGACCACACCAAGGGGCAGCCGTCCGAAGGCGAGAGCAGGAATGTTTTGACCGAGTCTGCGAGGATCGCCCGTGGCAAAATCACAGACCTGGCCAACCTCAGTGCAGCCAACCATGATGCTGCCATCTTTCCAGGAGGCTTTGGAGCGGCTAAAAACCTGAGCACGTTTGCCGTGGACGGGAAAGATTGCAAGGTGAATAAAGAAGTGGAGCGTGTCCTGAAGGAGTTCCACCAGGCCGGGAAGCCCATCGGCTTGTGCTGCATTGCACCTGTCCTCGCGGCCAAGGTGCTCAGAGGCGTCGAGGTGACTGTGGGCCACGAGCAGGAGGAAGGTGGCAAGTGGCCTTATGCCGGGACCGCAGAGGCCATCAAGGCCCTGGGTGCCAAGCACTGCGTGAAGGAAGTGGTCGAAGCTCACGTGGACCAGAAAAACAAGGTGGTCACGACCCCAGCCTTCATGTGCGAGACGGCACTCCACTACATCCATGATGGGATCGGAGCCATGGTGAGGAAGGTGCTGGAACTCACTGGAAAGTGA
ORF Protein Sequence MAAVRVLVASRLAAASAFTSLSPGGRTPSQRAALHLSVPRPAARVALVLSGCGVYDGTEIHEASAILVHLSRGGAEVQIFAPDVPQMHVIDHTKGQPSEGESRNVLTESARIARGKITDLANLSAANHDAAIFPGGFGAAKNLSTFAVDGKDCKVNKEVERVLKEFHQAGKPIGLCCIAPVLAAKVLRGVEVTVGHEQEEGGKWPYAGTAEAIKALGAKHCVKEVVEAHVDQKNKVVTTPAFMCETALHYIHDGIGAMVRKVLELTGK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1549-Ab Anti-GAL3A/ GATD3A/ C21orf33 functional antibody
    Target Antigen GM-Tg-g-SE1549-Ag GATD3A protein
    ORF Viral Vector pGMLP003494 Human GATD3A Lentivirus plasmid
    ORF Viral Vector vGMLP003494 Human GATD3A Lentivirus particle


    Target information

    Target ID GM-SE1549
    Target Name GATD3A
    Gene ID 8209, 28295, 713055, 294326, 101091803, 611316, 514335, 100057089
    Gene Symbol and Synonyms C1H21orf33,C21orf33,C26H21orf33,C31H21orf33,C3H21orf33,CC2H21orf33,D10Jhu81e,ES1,GATD3,GATD3A,GT335,HES1,KNPH,KNPI,RGD1303003
    Uniprot Accession P0DPI2
    Uniprot Entry Name GAL3A_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000160221
    Target Classification Not Available

    This gene encodes a potential mitochondrial protein that is a member of the DJ-1/PfpI gene family. This protein is overexpressed in fetal Down syndrome brain. Alternate splicing results in multiple transcript variants. [provided by RefSeq, May 2010]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.