Human FGF21 ORF/cDNA clone-Lentivirus plasmid (NM_019113)
Cat. No.: pGMLP003451
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human FGF21/ Lentiviral expression plasmid for FGF21 lentivirus packaging, FGF21 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
FGF21/ products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP003451 |
Gene Name | FGF21 |
Accession Number | NM_019113 |
Gene ID | 26291 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 630 bp |
Gene Alias | |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGACTCGGACGAGACCGGGTTCGAGCACTCAGGACTGTGGGTTTCTGTGCTGGCTGGTCTTCTGCTGGGAGCCTGCCAGGCACACCCCATCCCTGACTCCAGTCCTCTCCTGCAATTCGGGGGCCAAGTCCGGCAGCGGTACCTCTACACAGATGATGCCCAGCAGACAGAAGCCCACCTGGAGATCAGGGAGGATGGGACGGTGGGGGGCGCTGCTGACCAGAGCCCCGAAAGTCTCCTGCAGCTGAAAGCCTTGAAGCCGGGAGTTATTCAAATCTTGGGAGTCAAGACATCCAGGTTCCTGTGCCAGCGGCCAGATGGGGCCCTGTATGGATCGCTCCACTTTGACCCTGAGGCCTGCAGCTTCCGGGAGCTGCTTCTTGAGGACGGATACAATGTTTACCAGTCCGAAGCCCACGGCCTCCCGCTGCACCTGCCAGGGAACAAGTCCCCACACCGGGACCCTGCACCCCGAGGACCAGCTCGCTTCCTGCCACTACCAGGCCTGCCCCCCGCACTCCCGGAGCCACCCGGAATCCTGGCCCCCCAGCCCCCCGATGTGGGCTCCTCGGACCCTCTGAGCATGGTGGGACCTTCCCAGGGCCGAAGCCCCAGCTACGCTTCCTGA |
ORF Protein Sequence | MDSDETGFEHSGLWVSVLAGLLLGACQAHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T42928-Ab | Anti-FGF21 functional antibody |
Target Antigen | GM-Tg-g-T42928-Ag | FGF21 protein |
Cytokine | cks-Tg-g-GM-T42928 | fibroblast growth factor 21 (FGF21) protein & antibody |
ORF Viral Vector | pGMLP003451 | Human FGF21 Lentivirus plasmid |
ORF Viral Vector | pGMLV001311 | Human FGF21 Lentivirus plasmid |
ORF Viral Vector | pGMLV002194 | Human FGF21 Lentivirus plasmid |
ORF Viral Vector | pGMAAV000245 | Human FGF21 Adeno-associate virus(AAV) plasmid |
ORF Viral Vector | vGMLP003451 | Human FGF21 Lentivirus particle |
ORF Viral Vector | vGMLV001311 | Human FGF21 Lentivirus particle |
ORF Viral Vector | vGMLV002194 | Human FGF21 Lentivirus particle |
ORF Viral Vector | vGMAAV000245 | Human FGF21 Adeno-associate virus(AAV) particle |
Target information
Target ID | GM-T42928 |
Target Name | FGF21 |
Gene ID | 26291, 56636, 718288, 170580, 101080595, 484395, 785576, 100054542 |
Gene Symbol and Synonyms | FGF21,Fgf8c |
Uniprot Accession | Q9NSA1 |
Uniprot Entry Name | FGF21_HUMAN |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Therapeutics Target, Cytokine Target |
Disease | Not Available |
Gene Ensembl | ENSG00000105550 |
Target Classification | Not Available |
Theis gene encodes a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes. This protein is a secreted endocrine factor that functions as a major metabolic regulator. The encoded protein stimulates the uptake of glucose in adipose tissue. [provided by RefSeq, Mar 2016]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.