Human CRIP2/CRIP/CRP2 ORF/cDNA clone-Lentivirus plasmid (NM_001312)

Cat. No.: pGMLP003270
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CRIP2/CRIP/CRP2 Lentiviral expression plasmid for CRIP2 lentivirus packaging, CRIP2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to CRIP2/CRIP products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $456.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003270
Gene Name CRIP2
Accession Number NM_001312
Gene ID 1397
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 627 bp
Gene Alias CRIP,CRP2,ESP1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCCTCCAAATGCCCCAAGTGCGACAAGACCGTGTACTTCGCCGAGAAGGTGAGCTCCCTGGGGAAGGACTGGCACAAGTTCTGCCTCAAGTGCGAGCGCTGCAGCAAGACGCTGACGCCCGGGGGCCACGCCGAGCATGACGGGAAGCCGTTCTGCCACAAGCCGTGCTACGCCACCCTGTTCGGACCCAAAGGCGTGAACATCGGGGGCGCGGGCTCCTACATCTACGAGAAGCCCCTGGCGGAGGGGCCGCAGGTCACCGGCCCCATCGAGGTCCCCGCGGCCCGAGCAGAGGAGCGGAAGGCGAGCGGCCCCCCGAAGGGGCCCAGCAGAGCCTCCAGTGTCACCACTTTCACCGGGGAGCCCAACACGTGCCCGCGCTGCAGCAAGAAGGTGTACTTCGCTGAGAAGGTGACGTCTCTGGGCAAGGATTGGCACCGGCCCTGCCTGCGCTGCGAGCGCTGCGGGAAGACACTGACCCCCGGCGGGCACGCGGAGCACGACGGCCAGCCCTACTGCCACAAGCCCTGCTATGGAATCCTCTTCGGACCCAAGGGAGTGAACACCGGTGCGGTGGGCAGCTACATCTATGACCGGGACCCCGAAGGCAAGGTCCAGCCCTAG
ORF Protein Sequence MASKCPKCDKTVYFAEKVSSLGKDWHKFCLKCERCSKTLTPGGHAEHDGKPFCHKPCYATLFGPKGVNIGGAGSYIYEKPLAEGPQVTGPIEVPAARAEERKASGPPKGPSRASSVTTFTGEPNTCPRCSKKVYFAEKVTSLGKDWHRPCLRCERCGKTLTPGGHAEHDGQPYCHKPCYGILFGPKGVNTGAVGSYIYDRDPEGKVQP

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2438-Ab Anti-CRIP2 monoclonal antibody
    Target Antigen GM-Tg-g-IP2438-Ag CRIP2 protein
    ORF Viral Vector pGMLP003270 Human CRIP2 Lentivirus plasmid
    ORF Viral Vector vGMLP003270 Human CRIP2 Lentivirus particle


    Target information

    Target ID GM-IP2438
    Target Name CRIP2
    Gene ID 1397, 68337, 710186, 338401, 101090447, 612710, 780821, 100146542
    Gene Symbol and Synonyms 0610010I23Rik,CRIP,CRIP2,Crp,CRP2,CRP4,ESP1,Hlp
    Uniprot Accession P52943
    Uniprot Entry Name CRIP2_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Ovary Cancer
    Gene Ensembl ENSG00000182809
    Target Classification Not Available

    This gene encodes a putative transcription factor with two LIM zinc-binding domains. The encoded protein may participate in the differentiation of smooth muscle tissue. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.