Human FFAR2/FFA2R/GPR43 ORF/cDNA clone-Lentivirus plasmid (NM_005306)
Cat. No.: pGMLP003179
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human FFAR2/FFA2R/GPR43 Lentiviral expression plasmid for FFAR2 lentivirus packaging, FFAR2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
FFAR2/FFA2R products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP003179 |
Gene Name | FFAR2 |
Accession Number | NM_005306 |
Gene ID | 2867 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 993 bp |
Gene Alias | FFA2R,GPR43 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGCTGCCGGACTGGAAGAGCTCCTTGATCCTCATGGCTTACATCATCATCTTCCTCACTGGCCTCCCTGCCAACCTCCTGGCCCTGCGGGCCTTTGTGGGGCGGATCCGCCAGCCCCAGCCTGCACCTGTGCACATCCTCCTGCTGAGCCTGACGCTGGCCGACCTCCTCCTGCTGCTGCTGCTGCCCTTCAAGATCATCGAGGCTGCGTCGAACTTCCGCTGGTACCTGCCCAAGGTCGTCTGCGCCCTCACGAGTTTTGGCTTCTACAGCAGCATCTACTGCAGCACGTGGCTCCTGGCGGGCATCAGCATCGAGCGCTACCTGGGAGTGGCTTTCCCCGTGCAGTACAAGCTCTCCCGCCGGCCTCTGTATGGAGTGATTGCAGCTCTGGTGGCCTGGGTTATGTCCTTTGGTCACTGCACCATCGTGATCATCGTTCAATACTTGAACACGACTGAGCAGGTCAGAAGTGGCAATGAAATTACCTGCTACGAGAACTTCACCGATAACCAGTTGGACGTGGTGCTGCCCGTGCGGCTGGAGCTGTGCCTGGTGCTCTTCTTCATCCCCATGGCAGTCACCATCTTCTGCTACTGGCGTTTTGTGTGGATCATGCTCTCCCAGCCCCTTGTGGGGGCCCAGAGGCGGCGCCGAGCCGTGGGGCTGGCTGTGGTGACGCTGCTCAATTTCCTGGTGTGCTTCGGACCTTACAACGTGTCCCACCTGGTGGGGTATCACCAGAGAAAAAGCCCCTGGTGGCGGTCAATAGCCGTGGTGTTCAGTTCACTCAACGCCAGTCTGGACCCCCTGCTCTTCTATTTCTCTTCTTCAGTGGTGCGCAGGGCATTTGGGAGAGGGCTGCAGGTGCTGCGGAATCAGGGCTCCTCCCTGTTGGGACGCAGAGGCAAAGACACAGCAGAGGGGACAAATGAGGACAGGGGTGTGGGTCAAGGAGAAGGGATGCCAAGTTCGGACTTCACTACAGAGTAG |
ORF Protein Sequence | MLPDWKSSLILMAYIIIFLTGLPANLLALRAFVGRIRQPQPAPVHILLLSLTLADLLLLLLLPFKIIEAASNFRWYLPKVVCALTSFGFYSSIYCSTWLLAGISIERYLGVAFPVQYKLSRRPLYGVIAALVAWVMSFGHCTIVIIVQYLNTTEQVRSGNEITCYENFTDNQLDVVLPVRLELCLVLFFIPMAVTIFCYWRFVWIMLSQPLVGAQRRRRAVGLAVVTLLNFLVCFGPYNVSHLVGYHQRKSPWWRSIAVVFSSLNASLDPLLFYFSSSVVRRAFGRGLQVLRNQGSSLLGRRGKDTAEGTNEDRGVGQGEGMPSSDFTTE |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T28213-Ab | Anti-FFAR2/ FFA2R/ GPR43 monoclonal antibody |
Target Antigen | GM-Tg-g-T28213-Ag | FFAR2 VLP (virus-like particle) |
ORF Viral Vector | pGMLP003179 | Human FFAR2 Lentivirus plasmid |
ORF Viral Vector | vGMLP003179 | Human FFAR2 Lentivirus particle |
Target information
Target ID | GM-T28213 |
Target Name | FFAR2 |
Gene ID | 2867, 233079, 709026, 292794, 101082709, 484580 |
Gene Symbol and Synonyms | FFA2R,FFAR2,GPCR43,GPR43 |
Uniprot Accession | O15552 |
Uniprot Entry Name | FFAR2_HUMAN |
Protein Sub-location | Transmembrane Protein |
Category | Therapeutics Target |
Disease | Not Available |
Gene Ensembl | ENSG00000126262 |
Target Classification | Not Available |
This gene encodes a member of the GP40 family of G protein-coupled receptors that are clustered together on chromosome 19. The encoded protein is a receptor for short chain free fatty acids and may be involved in the inflammatory response and in regulating lipid plasma levels. [provided by RefSeq, Apr 2009]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.