Human GJA4/CX37 ORF/cDNA clone-Lentivirus plasmid (NM_002060)

Cat. No.: pGMLP003021
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human GJA4/CX37 Lentiviral expression plasmid for GJA4 lentivirus packaging, GJA4 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to Cx37/GJA4/CX37 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $580.56
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003021
Gene Name GJA4
Accession Number NM_002060
Gene ID 2701
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 1002 bp
Gene Alias CX37
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGTGACTGGGGCTTCCTGGAGAAGTTGCTGGACCAGGTCCAGGAGCACTCGACCGTGGTGGGTAAGATCTGGCTGACGGTGCTCTTCATCTTCCGCATCCTCATCCTGGGCCTGGCCGGCGAGTCAGTGTGGGGTGACGAGCAATCAGATTTCGAGTGTAACACGGCCCAGCCAGGCTGCACCAACGTCTGCTATGACCAGGCCTTCCCCATCTCCCACATCCGCTACTGGGTGCTGCAGTTCCTCTTCGTCAGCACACCCACCCTGGTCTACCTGGGCCATGTCATTTACCTGTCTCGGCGAGAAGAGCGGCTGCGGCAGAAGGAGGGGGAGCTGCGGGCACTGCCGGCCAAGGACCCACAGGTGGAGCGGGCGCTGGCGGCCGTAGAGCGTCAGATGGCCAAGATCTCGGTGGCAGAAGATGGTCGCCTGCGCATCCGCGGAGCACTGATGGGCACCTATGTCGCCAGTGTGCTCTGCAAGAGTGTGCTAGAGGCAGGCTTCCTCTATGGCCAGTGGCGCCTGTACGGCTGGACCATGGAGCCCGTGTTTGTGTGCCAGCGAGCACCCTGCCCCTACCTCGTGGACTGCTTTGTCTCTCGCCCCACGGAGAAGACCATCTTCATCATCTTCATGTTGGTGGTTGGACTCATCTCCCTGGTGCTTAACCTGCTGGAGTTGGTGCACCTGCTGTGTCGCTGCCTCAGCCGGGGGATGAGGGCACGGCAAGGCCAAGACGCACCCCCGACCCAGGGCACCTCCTCAGACCCTTACACGGACCAGGTCTTCTTCTACCTCCCCGTGGGCCAGGGGCCCTCATCCCCACCATGCCCCACCTACAATGGGCTCTCATCCAGTGAGCAGAACTGGGCCAACCTGACCACAGAGGAGAGGCTGGCGTCTTCCAGGCCCCCTCTCTTCCTGGACCCACCCCCTCAGAATGGCCAAAAACCCCCAAGTCGTCCCAGCAGCTCTGCTTCTAAGAAGCAGTATGTATAG
ORF Protein Sequence MGDWGFLEKLLDQVQEHSTVVGKIWLTVLFIFRILILGLAGESVWGDEQSDFECNTAQPGCTNVCYDQAFPISHIRYWVLQFLFVSTPTLVYLGHVIYLSRREERLRQKEGELRALPAKDPQVERALAAVERQMAKISVAEDGRLRIRGALMGTYVASVLCKSVLEAGFLYGQWRLYGWTMEPVFVCQRAPCPYLVDCFVSRPTEKTIFIIFMLVVGLISLVLNLLELVHLLCRCLSRGMRARQGQDAPPTQGTSSDPYTDQVFFYLPVGQGPSSPPCPTYNGLSSSEQNWANLTTEERLASSRPPLFLDPPPQNGQKPPSRPSSSASKKQYV

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0179-Ab Anti-Cx37 monoclonal antibody
    Target Antigen GM-Tg-g-IP0179-Ag Cx37/GJA4 protein
    ORF Viral Vector pGMLP003021 Human GJA4 Lentivirus plasmid
    ORF Viral Vector vGMLP003021 Human GJA4 Lentivirus particle


    Target information

    Target ID GM-IP0179
    Target Name Cx37
    Gene ID 2701, 14612, 710913, 25655, 101084041, 538913, 100055536
    Gene Symbol and Synonyms Cnx37,CX37,CXN37,Cxnh1,Gja-4,GJA4
    Uniprot Accession P35212
    Uniprot Entry Name CXA4_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000187513
    Target Classification Not Available

    This gene encodes a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. Mutations in this gene have been associated with atherosclerosis and a higher risk of myocardial infarction. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.