Human LITAF/PIG7/SIMPLE ORF/cDNA clone-Lentivirus plasmid (NM_004862)
Cat. No.: pGMLP002939
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human LITAF/PIG7/SIMPLE Lentiviral expression plasmid for LITAF lentivirus packaging, LITAF lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
LITAF/PIG7 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP002939 |
Gene Name | LITAF |
Accession Number | NM_004862 |
Gene ID | 9516 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 486 bp |
Gene Alias | PIG7,SIMPLE,TP53I7 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGTCGGTTCCAGGACCTTACCAGGCGGCCACTGGGCCTTCCTCAGCACCATCCGCACCTCCATCCTATGAAGAGACAGTGGCTGTTAACAGTTATTACCCCACACCTCCAGCTCCCATGCCTGGGCCAACTACGGGGCTTGTGACGGGGCCTGATGGGAAGGGCATGAATCCTCCTTCGTATTATACCCAGCCAGCGCCCATCCCCAATAACAATCCAATTACCGTGCAGACGGTCTACGTGCAGCACCCCATCACCTTTTTGGACCGCCCTATCCAAATGTGTTGTCCTTCCTGCAACAAGATGATCGTGAGTCAGCTGTCCTATAACGCCGGTGCTCTGACCTGGCTGTCCTGCGGGAGCCTGTGCCTGCTGGGGTGCATAGCGGGCTGCTGCTTCATCCCCTTCTGCGTGGATGCCCTGCAGGACGTGGACCATTACTGTCCCAACTGCAGAGCTCTCCTGGGCACCTACAAGCGTTTGTAG |
ORF Protein Sequence | MSVPGPYQAATGPSSAPSAPPSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPSYYTQPAPIPNNNPITVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSCGSLCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKRL |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-MP0737-Ab | Anti-LITAF/ PIG7/ SIMPLE monoclonal antibody |
Target Antigen | GM-Tg-g-MP0737-Ag | LITAF VLP (virus-like particle) |
ORF Viral Vector | pGMLP002939 | Human LITAF Lentivirus plasmid |
ORF Viral Vector | vGMLP002939 | Human LITAF Lentivirus particle |
Target information
Target ID | GM-MP0737 |
Target Name | LITAF |
Gene ID | 9516, 56722, 711743, 65161, 101083562, 490004, 520564, 100033923 |
Gene Symbol and Synonyms | 3222402J11Rik,EET-1,LITAF,N4WBP3,PIG7,SIMPLE,TBX1,TP53I7 |
Uniprot Accession | Q99732 |
Uniprot Entry Name | LITAF_HUMAN |
Protein Sub-location | Transmembrane Protein |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000189067 |
Target Classification | Not Available |
Lipopolysaccharide is a potent stimulator of monocytes and macrophages, causing secretion of tumor necrosis factor-alpha (TNF-alpha) and other inflammatory mediators. This gene encodes lipopolysaccharide-induced TNF-alpha factor, which is a DNA-binding protein and can mediate the TNF-alpha expression by direct binding to the promoter region of the TNF-alpha gene. The transcription of this gene is induced by tumor suppressor p53 and has been implicated in the p53-induced apoptotic pathway. Mutations in this gene cause Charcot-Marie-Tooth disease type 1C (CMT1C) and may be involved in the carcinogenesis of extramammary Paget's disease (EMPD). Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Dec 2014]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.