Human IL22/IL-21/IL-22 ORF/cDNA clone-Lentivirus plasmid (NM_020525)
Cat. No.: pGMLP002305
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human IL22/IL-21/IL-22 Lentiviral expression plasmid for IL22 lentivirus packaging, IL22 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
IL22/IL-21 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP002305 |
Gene Name | IL22 |
Accession Number | NM_020525 |
Gene ID | 50616 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 540 bp |
Gene Alias | IL-21,IL-22,IL-D110,IL-TIF,ILTIF,TIFa,TIFIL-23,zcyto18 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGCCGCCCTGCAGAAATCTGTGAGCTCTTTCCTTATGGGGACCCTGGCCACCAGCTGCCTCCTTCTCTTGGCCCTCTTGGTACAGGGAGGAGCAGCTGCGCCCATCAGCTCCCACTGCAGGCTTGACAAGTCCAACTTCCAGCAGCCCTATATCACCAACCGCACCTTCATGCTGGCTAAGGAGGCTAGCTTGGCTGATAACAACACAGACGTTCGTCTCATTGGGGAGAAACTGTTCCACGGAGTCAGTATGAGTGAGCGCTGCTATCTGATGAAGCAGGTGCTGAACTTCACCCTTGAAGAAGTGCTGTTCCCTCAATCTGATAGGTTCCAGCCTTATATGCAGGAGGTGGTGCCCTTCCTGGCCAGGCTCAGCAACAGGCTAAGCACATGTCATATTGAAGGTGATGACCTGCATATCCAGAGGAATGTGCAAAAGCTGAAGGACACAGTGAAAAAGCTTGGAGAGAGTGGAGAGATCAAAGCAATTGGAGAACTGGATTTGCTGTTTATGTCTCTGAGAAATGCCTGCATTTGA |
ORF Protein Sequence | MAALQKSVSSFLMGTLATSCLLLLALLVQGGAAAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Biosimilar | GMP-Bios-ab-209 | Pre-Made Fezakinumab biosimilar, Whole mAb, Anti-IL22 Antibody: Anti-IL-21/IL-22/IL-D110/IL-TIF/ILTIF/TIFIL-23/TIFa/zcyto18 therapeutic antibody |
Target Antibody | GM-Tg-g-T44682-Ab | Anti-IL22/ IL-21/ IL-22 functional antibody |
Target Antigen | GM-Tg-g-T44682-Ag | IL22 protein |
Cytokine | cks-Tg-g-GM-T44682 | Interleukin 22 (IL22) protein & antibody |
ORF Viral Vector | pGMLP002305 | Human IL22 Lentivirus plasmid |
ORF Viral Vector | pGMLP-IL-029 | Human IL22 Lentivirus plasmid |
ORF Viral Vector | pGMAP-IL-112 | Human IL22 Adenovirus plasmid |
ORF Viral Vector | vGMLP002305 | Human IL22 Lentivirus particle |
ORF Viral Vector | vGMLP-IL-029 | Human IL22 Lentivirus particle |
ORF Viral Vector | vGMAP-IL-112 | Human IL22 Adenovirus particle |
Target information
Target ID | GM-T44682 |
Target Name | IL22 |
Gene ID | 50616, 718047, 500836, 101095184, 481153, 507778, 100058976 |
Gene Symbol and Synonyms | If2b1,IL-21,IL-22,IL-D110,IL-TIF,IL22,ILTIF,RGD1561292,TIFa,TIFIL-23,zcyto18 |
Uniprot Accession | Q9GZX6 |
Uniprot Entry Name | IL22_HUMAN |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Therapeutics Target, INN Index, Cytokine Target |
Disease | Not Available |
Gene Ensembl | ENSG00000127318 |
Target Classification | Not Available |
This gene is a member of the IL10 family of cytokines that mediate cellular inflammatory responses. The encoded protein functions in antimicrobial defense at mucosal surfaces and in tissue repair. This protein also has pro-inflammatory properties and plays a role in in the pathogenesis of several intestinal diseases. The encoded protein is a crucial cytokine that regulates host immunity in infectious diseases, including COVID-19 (disease caused by SARS-CoV-2). [provided by RefSeq, Dec 2021]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.