Human RAB27B/C25KG ORF/cDNA clone-Lentivirus plasmid (NM_004163)

Cat. No.: pGMLP002172
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human RAB27B/C25KG Lentiviral expression plasmid for RAB27B lentivirus packaging, RAB27B lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to RAB27B/C25KG products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $464.25
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002172
Gene Name RAB27B
Accession Number NM_004163
Gene ID 5874
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 657 bp
Gene Alias C25KG
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGACCGATGGAGACTATGATTATCTGATCAAACTCCTGGCCCTCGGGGATTCAGGGGTGGGGAAGACAACATTTCTTTATAGATACACAGATAATAAATTCAATCCCAAATTCATCACTACAGTAGGAATAGACTTTCGGGAAAAACGTGTGGTTTATAATGCACAAGGACCGAATGGATCTTCAGGGAAAGCATTTAAAGTGCATCTTCAGCTTTGGGACACTGCGGGACAAGAGCGGTTCCGGAGTCTCACCACTGCATTTTTCAGAGACGCCATGGGCTTCTTATTAATGTTTGACCTCACCAGTCAACAGAGCTTCTTAAATGTCAGAAACTGGATGAGCCAACTGCAAGCAAATGCTTATTGTGAAAATCCAGATATAGTATTAATTGGCAACAAGGCAGACCTACCAGATCAGAGGGAAGTCAATGAACGGCAAGCTCGGGAACTGGCTGACAAATATGGCATACCATATTTTGAAACAAGTGCAGCAACTGGACAGAATGTGGAGAAAGCTGTAGAAACCCTTTTGGACTTAATCATGAAGCGAATGGAACAGTGTGTGGAGAAGACACAAATCCCTGATACTGTCAATGGTGGAAATTCTGGAAACTTGGATGGGGAAAAGCCACCAGAGAAGAAATGTATCTGCTAG
ORF Protein Sequence MTDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAQGPNGSSGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDLIMKRMEQCVEKTQIPDTVNGGNSGNLDGEKPPEKKCIC

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP2275-Ab Anti-RB27B/ RAB27B/ C25KG monoclonal antibody
    Target Antigen GM-Tg-g-MP2275-Ag RAB27B VLP (virus-like particle)
    ORF Viral Vector pGMLP002172 Human RAB27B Lentivirus plasmid
    ORF Viral Vector vGMLP002172 Human RAB27B Lentivirus particle


    Target information

    Target ID GM-MP2275
    Target Name RAB27B
    Gene ID 5874, 80718, 694445, 84590, 101096852, 483974, 282858, 100049861
    Gene Symbol and Synonyms 2310021G14Rik,B130064M09Rik,C25KG,RAB27B
    Uniprot Accession O00194
    Uniprot Entry Name RB27B_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000041353
    Target Classification Not Available

    Members of the Rab protein family, including RAB27B, are prenylated, membrane-bound proteins involved in vesicular fusion and trafficking (Chen et al., 1997 [PubMed 9066979]).[supplied by OMIM, Nov 2010]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.