Human CXCL10/C7/crg-2 ORF/cDNA clone-Lentivirus plasmid (NM_001565.3)

Cat. No.: pGMLP001931
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CXCL10/C7/crg-2 Lentiviral expression plasmid for CXCL10 lentivirus packaging, CXCL10 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to CXCL10/C7 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP001931
Gene Name CXCL10
Accession Number NM_001565.3
Gene ID 3627
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 297 bp
Gene Alias C7,crg-2,gIP-10,IFI10,INP10,IP-10,mob-1,SCYB10
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAATCAAACTGCCATTCTGATTTGCTGCCTTATCTTTCTGACTCTAAGTGGCATTCAAGGAGTACCTCTCTCTAGAACTGTACGCTGTACCTGCATCAGCATTAGTAATCAACCTGTTAATCCAAGGTCTTTAGAAAAACTTGAAATTATTCCTGCAAGCCAATTTTGTCCACGTGTTGAGATCATTGCTACAATGAAAAAGAAGGGTGAGAAGAGATGTCTGAATCCAGAATCGAAGGCCATCAAGAATTTACTGAAAGCAGTTAGCAAGGAAAGGTCTAAAAGATCTCCTTAA
ORF Protein Sequence MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-ab-168 Pre-Made Eldelumab biosimilar, Whole mAb, Anti-CXCL10 Antibody: Anti-C7/IFI10/INP10/IP-10/SCYB10/crg-2/gIP-10/mob-1 therapeutic antibody
    Target Antibody GM-Tg-g-T30635-Ab Anti-CXL10/ CXCL10/ C7 functional antibody
    Target Antigen GM-Tg-g-T30635-Ag CXCL10 protein
    Cytokine cks-Tg-g-GM-T30635 chemokine (C-X-C motif) ligand 10 (CXCL10) protein & antibody
    ORF Viral Vector pGMLP001931 Human CXCL10 Lentivirus plasmid
    ORF Viral Vector pGMAP000053 Human CXCL10 Adenovirus plasmid
    ORF Viral Vector vGMLP001931 Human CXCL10 Lentivirus particle
    ORF Viral Vector vGMAP000053 Human CXCL10 Adenovirus particle


    Target information

    Target ID GM-T30635
    Target Name CXCL10
    Gene ID 3627, 574243, 245920, 101100131, 478432, 615107, 100050993
    Gene Symbol and Synonyms C7,crg-2,CXCL10,gIP-10,IFI10,INP10,IP-10,mob-1,SCYB10
    Uniprot Accession P02778
    Uniprot Entry Name CXL10_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, INN Index, Cytokine Target
    Disease Breast Cancer, Complications of kidney transplant, Bacterial sepsis of newborn, Acute kidney failure
    Gene Ensembl ENSG00000169245
    Target Classification Not Available

    This antimicrobial gene encodes a chemokine of the CXC subfamily and ligand for the receptor CXCR3. Binding of this protein to CXCR3 results in pleiotropic effects, including stimulation of monocytes, natural killer and T-cell migration, and modulation of adhesion molecule expression. This gene may also be a key regulator of the 'cytokine storm' immune response to SARS-CoV-2 infection. [provided by RefSeq, Sep 2020]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.