Human TMEM167B/AD-020/C1orf119 ORF/cDNA clone-Lentivirus plasmid (NM_020141.3)

Cat. No.: pGMLP001261
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human TMEM167B/AD-020/C1orf119 Lentiviral expression plasmid for TMEM167B lentivirus packaging, TMEM167B lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to TMEM167B/AD-020 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP001261
Gene Name TMEM167B
Accession Number NM_020141.3
Gene ID 56900
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 225 bp
Gene Alias AD-020,C1orf119
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGACGAACGTGTACTCCTTGGATGGGATTCTGGTGTTTGGTTTGCTCTTTGTTTGCACCTGTGCCTACTTCAAGAAAGTACCTCGTCTCAAAACCTGGCTGCTATCAGAGAAGAAGGGTGTTTGGGGTGTGTTTTACAAAGCCGCTGTGATTGGAACCAGGCTGCATGCTGCTGTGGCAATTGCTTGTGTTGTAATGGCCTTTTACGTCCTGTTTATAAAATGA
ORF Protein Sequence MTNVYSLDGILVFGLLFVCTCAYFKKVPRLKTWLLSEKKGVWGVFYKAAVIGTRLHAAVAIACVVMAFYVLFIK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2006-Ab Anti-TMEM167B monoclonal antibody
    Target Antigen GM-Tg-g-IP2006-Ag TMEM167B protein
    ORF Viral Vector pGMLP001261 Human TMEM167B Lentivirus plasmid
    ORF Viral Vector vGMLP001261 Human TMEM167B Lentivirus particle


    Target information

    Target ID GM-IP2006
    Target Name TMEM167B
    Gene ID 56900, 67495, 697418, 499690, 101097330, 100688675, 613426, 100629819
    Gene Symbol and Synonyms 2010200O16Rik,AD-020,C1orf119,C3H1orf119,RGD1564454,TMEM167B
    Uniprot Accession Q9NRX6
    Uniprot Entry Name KISHB_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000215717
    Target Classification Not Available

    Involved in constitutive secretory pathway. Located in Golgi apparatus. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.