Human ASIP/AGSW/AGTI ORF/cDNA clone-Lentivirus plasmid (NM_001672)

Cat. No.: pGMLP000914
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human ASIP/AGSW/AGTI Lentiviral expression plasmid for ASIP lentivirus packaging, ASIP lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to ASIP/AGSW products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000914
Gene Name ASIP
Accession Number NM_001672
Gene ID 434
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 399 bp
Gene Alias AGSW,AGTI,AGTIL,ASP,SHEP9
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGATGTCACCCGCTTACTCCTGGCCACCCTGCTGGTCTTCCTCTGCTTCTTCACTGCCAACAGCCACCTGCCACCTGAGGAGAAGCTCCGAGATGACAGGAGCCTGAGAAGCAACTCCTCTGTGAACCTACTGGATGTCCCTTCTGTCTCTATTGTGGCGCTGAACAAGAAATCCAAACAGATCGGCAGAAAAGCAGCAGAAAAGAAAAGATCTTCTAAGAAGGAGGCTTCGATGAAGAAAGTGGTGCGGCCCCGGACCCCCCTATCTGCGCCCTGCGTGGCCACCCGCAACAGCTGCAAGCCGCCGGCACCCGCCTGCTGCGACCCGTGCGCCTCCTGCCAGTGCCGCTTCTTCCGCAGCGCCTGCTCCTGCCGCGTGCTCAGCCTCAACTGCTGA
ORF Protein Sequence MDVTRLLLATLLVFLCFFTANSHLPPEEKLRDDRSLRSNSSVNLLDVPSVSIVALNKKSKQIGRKAAEKKRSSKKEASMKKVVRPRTPLSAPCVATRNSCKPPAPACCDPCASCQCRFFRSACSCRVLSLNC

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0681-Ab Anti-ASIP/ AGSW/ AGTI functional antibody
    Target Antigen GM-Tg-g-SE0681-Ag ASIP protein
    ORF Viral Vector pGMLP000914 Human ASIP Lentivirus plasmid
    ORF Viral Vector vGMLP000914 Human ASIP Lentivirus particle


    Target information

    Target ID GM-SE0681
    Target Name ASIP
    Gene ID 434, 50518, 709156, 24152, 492297, 492296, 404192, 100054335
    Gene Symbol and Synonyms a,A,agouti,AGSW,AGTI,AGTIL,As,ASIP,ASP,SHEP9
    Uniprot Accession P42127
    Uniprot Entry Name ASIP_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Cancer
    Gene Ensembl ENSG00000101440
    Target Classification Tumor-associated antigen (TAA)

    In mice, the agouti gene encodes a paracrine signaling molecule that causes hair follicle melanocytes to synthesize pheomelanin, a yellow pigment, instead of the black or brown pigment, eumelanin. Pleiotropic effects of constitutive expression of the mouse gene include adult-onset obesity, increased tumor susceptibility, and premature infertility. This gene is highly similar to the mouse gene and encodes a secreted protein that may (1) affect the quality of hair pigmentation, (2) act as a pharmacological antagonist of alpha-melanocyte-stimulating hormone, (3) play a role in neuroendocrine aspects of melanocortin action, and (4) have a functional role in regulating lipid metabolism in adipocytes. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.