Human GPR55/LPIR1 ORF/cDNA clone-Lentivirus plasmid (NM_005683)

Cat. No.: pGMLP000400
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human GPR55/LPIR1 Lentiviral expression plasmid for GPR55 lentivirus packaging, GPR55 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to GPR55/LPIR1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $540
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000400
Gene Name GPR55
Accession Number NM_005683
Gene ID 9290
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 960 bp
Gene Alias LPIR1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAGTCAGCAAAACACCAGTGGGGACTGCCTGTTTGACGGTGTCAACGAGCTGATGAAAACCCTACAGTTTGCAGTCCACATCCCCACCTTCGTCCTGGGCCTGCTCCTCAACCTGCTGGCCATCCATGGCTTCAGCACCTTCCTTAAGAACAGGTGGCCCGATTATGCTGCCACCTCCATCTACATGATCAACCTGGCAGTCTTTGACCTGCTGCTGGTGCTCTCCCTCCCATTCAAGATGGTCCTGTCCCAGGTACAGTCCCCCTTCCCGTCCCTGTGCACCCTGGTGGAGTGCCTTTACTTCGTCAGCATGTACGGAAGCGTCTTCACCATCTGCTTCATCAGCATGGACCGGTTCTTGGCCATCCGTTACCCGCTACTGGTGAGCCACCTCCGGTCCCCCAGGAAGATCTTTGGGATCTGCTGCACCATCTGGGTCCTGGTGTGGACCGGAAGCATCCCTATCTACAGTTTCCATGGGAAAGTGGAAAAATACATGTGCTTCCACAACATGTCTGATGATACCTGGAGCGCCAAGGTCTTCTTCCCGCTGGAGGTGTTTGGCTTCCTCCTTCCCATGGGCATCATGGGCTTCTGCTGCTCCAGGAGCATCCACATCCTGCTGGGCCGCCGAGACCACACCCAGGACTGGGTGCAGCAGAAAGCCTGCATCTACAGCATCGCAGCCAGCCTGGCTGTCTTCGTGGTCTCCTTCCTCCCAGTCCACCTGGGGTTCTTCCTGCAGTTCCTGGTGAGAAACAGCTTTATCGTAGAGTGCAGAGCCAAGCAGAGCATCAGCTTCTTCTTGCAATTGTCCATGTGTTTCTCCAACGTCAACTGCTGCCTGGATGTTTTCTGCTACTACTTTGTCATCAAAGAATTCCGCATGAACATCAGGGCCCACCGGCCTTCCAGGGTCCAGCTGGTCCTGCAGGACACCACGATCTCCCGGGGCTAA
ORF Protein Sequence MSQQNTSGDCLFDGVNELMKTLQFAVHIPTFVLGLLLNLLAIHGFSTFLKNRWPDYAATSIYMINLAVFDLLLVLSLPFKMVLSQVQSPFPSLCTLVECLYFVSMYGSVFTICFISMDRFLAIRYPLLVSHLRSPRKIFGICCTIWVLVWTGSIPIYSFHGKVEKYMCFHNMSDDTWSAKVFFPLEVFGFLLPMGIMGFCCSRSIHILLGRRDHTQDWVQQKACIYSIAASLAVFVVSFLPVHLGFFLQFLVRNSFIVECRAKQSISFFLQLSMCFSNVNCCLDVFCYYFVIKEFRMNIRAHRPSRVQLVLQDTTISRG

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0028-Ab Anti-GPR55 monoclonal antibody
    Target Antigen GM-Tg-g-IP0028-Ag GPR55 protein
    ORF Viral Vector pGMLP000400 Human GPR55 Lentivirus plasmid
    ORF Viral Vector vGMLP000400 Human GPR55 Lentivirus particle


    Target information

    Target ID GM-IP0028
    Target Name GPR55
    Gene ID 9290, 227326, 711323, 501177, 101094199, 486157, 539107, 100063969
    Gene Symbol and Synonyms CTFL,Gm218,GPR55,LPIR1
    Uniprot Accession Q9Y2T6
    Uniprot Entry Name GPR55_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000135898
    Target Classification Not Available

    This gene belongs to the G-protein-coupled receptor superfamily. The encoded integral membrane protein is a likely cannabinoid receptor. It may be involved in several physiological and pathological processes by activating a variety of signal transduction pathways. [provided by RefSeq, Aug 2013]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.