Human RAMP1 ORF/cDNA clone-Lentivirus plasmid (NM_005855)

Cat. No.: pGMLP000292
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human RAMP1/ Lentiviral expression plasmid for RAMP1 lentivirus packaging, RAMP1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to RAMP1/ products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000292
Gene Name RAMP1
Accession Number NM_005855
Gene ID 10267
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 447 bp
Gene Alias
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCCCGGGCCCTGTGCCGCCTCCCGCGGCGCGGCCTCTGGCTGCTCCTGGCCCATCACCTCTTCATGACCACTGCCTGCCAGGAGGCTAACTACGGTGCCCTCCTCCGGGAGCTCTGCCTCACCCAGTTCCAGGTAGACATGGAGGCCGTCGGGGAGACGCTGTGGTGTGACTGGGGCAGGACCATCAGGAGCTACAGGGAGCTGGCCGACTGCACCTGGCACATGGCGGAGAAGCTGGGCTGCTTCTGGCCCAATGCAGAGGTGGACAGGTTCTTCCTGGCAGTGCATGGCCGCTACTTCAGGAGCTGCCCCATCTCAGGCAGGGCCGTGCGGGACCCGCCCGGCAGCATCCTCTACCCCTTCATCGTGGTCCCCATCACGGTGACCCTGCTGGTGACGGCACTGGTGGTCTGGCAGAGCAAGCGCACTGAGGGCATTGTGTAG
ORF Protein Sequence MARALCRLPRRGLWLLLAHHLFMTTACQEANYGALLRELCLTQFQVDMEAVGETLWCDWGRTIRSYRELADCTWHMAEKLGCFWPNAEVDRFFLAVHGRYFRSCPISGRAVRDPPGSILYPFIVVPITVTLLVTALVVWQSKRTEGIV

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP1451-Ab Anti-RAMP1 monoclonal antibody
    Target Antigen GM-Tg-g-MP1451-Ag RAMP1 VLP (virus-like particle)
    ORF Viral Vector pGMLP000292 Human RAMP1 Lentivirus plasmid
    ORF Viral Vector vGMLP000292 Human RAMP1 Lentivirus particle


    Target information

    Target ID GM-MP1451
    Target Name RAMP1
    Gene ID 10267, 51801, 574329, 58965, 101092133, 607163, 617017, 100066550
    Gene Symbol and Synonyms 9130218E19Rik,RAMP1
    Uniprot Accession O60894
    Uniprot Entry Name RAMP1_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000132329
    Target Classification Not Available

    The protein encoded by this gene is a member of the RAMP family of single-transmembrane-domain proteins, called receptor (calcitonin) activity modifying proteins (RAMPs). RAMPs are type I transmembrane proteins with an extracellular N terminus and a cytoplasmic C terminus. RAMPs are required to transport calcitonin-receptor-like receptor (CRLR) to the plasma membrane. CRLR, a receptor with seven transmembrane domains, can function as either a calcitonin-gene-related peptide (CGRP) receptor or an adrenomedullin receptor, depending on which members of the RAMP family are expressed. In the presence of this (RAMP1) protein, CRLR functions as a CGRP receptor. The RAMP1 protein is involved in the terminal glycosylation, maturation, and presentation of the CGRP receptor to the cell surface. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Apr 2015]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.