Human SLC39A1/ZIP1/ZIRTL ORF/cDNA clone-Lentivirus plasmid (NM_014437)

Cat. No.: pGMLP000169
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human SLC39A1/ZIP1/ZIRTL Lentiviral expression plasmid for SLC39A1 lentivirus packaging, SLC39A1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to SLC39A1/ZIP1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $543.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000169
Gene Name SLC39A1
Accession Number NM_014437
Gene ID 27173
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 975 bp
Gene Alias ZIP1,ZIRTL
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGGCCCTGGGGAGAGCCAGAGCTCCTGGTGTGGCGCCCCGAGGCGGTAGCTTCAGAGCCTCCAGTGCCTGTGGGGCTGGAGGTGAAGTTGGGGGCCCTGGTGCTGCTGCTGGTGCTCACCCTCCTCTGCAGCCTGGTGCCCATCTGTGTGCTGCGCCGGCCAGGAGCTAACCATGAAGGCTCAGCTTCCCGCCAGAAAGCCCTGAGCCTAGTAAGCTGTTTCGCGGGGGGCGTCTTTTTGGCCACTTGTCTCCTGGACCTGCTGCCTGACTACCTGGCTGCCATAGATGAGGCCCTGGCAGCCTTGCACGTGACGCTCCAGTTCCCACTGCAAGAGTTCATCCTGGCCATGGGCTTCTTCCTGGTCCTGGTGATGGAGCAGATCACACTGGCTTACAAGGAGCAGTCAGGGCCGTCACCTCTGGAGGAAACAAGGGCTCTGCTGGGAACAGTGAATGGTGGGCCGCAGCATTGGCATGATGGGCCAGGGGTCCCACAGGCGAGTGGAGCCCCAGCAACCCCCTCAGCCTTGCGTGCCTGTGTACTGGTGTTCTCCCTGGCCCTCCACTCCGTGTTCGAGGGGCTGGCGGTAGGGCTGCAGCGAGACCGGGCTCGGGCCATGGAGCTGTGCCTGGCTTTGCTGCTCCACAAGGGCATCCTGGCTGTCAGCCTGTCCCTGCGGCTGTTGCAGAGCCACCTTAGGGCACAGGTGGTGGCTGGCTGTGGGATCCTCTTCTCATGCATGACACCTCTAGGCATCGGGCTGGGTGCAGCTCTGGCAGAGTCGGCAGGACCTCTGCACCAGCTGGCCCAGTCTGTGCTAGAGGGCATGGCAGCTGGCACCTTTCTCTATATCACCTTTCTGGAAATCCTGCCCCAGGAGCTGGCCAGTTCTGAGCAAAGGATCCTCAAGGTCATTCTGCTCCTAGCAGGCTTTGCCCTGCTCACTGGCCTGCTCTTCATCCAAATCTAG
ORF Protein Sequence MGPWGEPELLVWRPEAVASEPPVPVGLEVKLGALVLLLVLTLLCSLVPICVLRRPGANHEGSASRQKALSLVSCFAGGVFLATCLLDLLPDYLAAIDEALAALHVTLQFPLQEFILAMGFFLVLVMEQITLAYKEQSGPSPLEETRALLGTVNGGPQHWHDGPGVPQASGAPATPSALRACVLVFSLALHSVFEGLAVGLQRDRARAMELCLALLLHKGILAVSLSLRLLQSHLRAQVVAGCGILFSCMTPLGIGLGAALAESAGPLHQLAQSVLEGMAAGTFLYITFLEILPQELASSEQRILKVILLLAGFALLTGLLFIQI

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP1613-Ab Anti-S39A1/ SLC39A1/ ZIP1 monoclonal antibody
    Target Antigen GM-Tg-g-MP1613-Ag SLC39A1 VLP (virus-like particle)
    ORF Viral Vector pGMLP000169 Human SLC39A1 Lentivirus plasmid
    ORF Viral Vector vGMLP000169 Human SLC39A1 Lentivirus particle


    Target information

    Target ID GM-MP1613
    Target Name SLC39A1
    Gene ID 27173, 30791, 715994, 361986, 101100859, 100855713, 530352, 100062274
    Gene Symbol and Synonyms SLC39A1,ZIP1,ZIRTL
    Uniprot Accession Q9NY26
    Uniprot Entry Name S39A1_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000143570
    Target Classification Not Available

    This gene encodes a member of the zinc-iron permease family. The encoded protein is localized to the cell membrane and acts as a zinc uptake transporter. This gene has been linked to prostate cancer, breast cancer, and Alzheimer's disease. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2012]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.