Human XCL1/ATAC/LPTN ORF/cDNA clone-Lentivirus plasmid (NM_002995)
Cat. No.: pGMLP000163
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human XCL1/ATAC/LPTN Lentiviral expression plasmid for XCL1 lentivirus packaging, XCL1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
XCL1/ATAC products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP000163 |
Gene Name | XCL1 |
Accession Number | NM_002995 |
Gene ID | 6375 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 345 bp |
Gene Alias | ATAC,LPTN,LTN,SCM-1,SCM-1a,SCM1,SCM1A,SCYC1 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGAGACTTCTCATCCTGGCCCTCCTTGGCATCTGCTCTCTCACTGCATACATTGTGGAAGGTGTAGGGAGTGAAGTCTCAGATAAGAGGACCTGTGTGAGCCTCACTACCCAGCGACTGCCGGTTAGCAGAATCAAGACCTACACCATCACGGAAGGCTCCTTGAGAGCAGTAATTTTTATTACCAAACGTGGCCTAAAAGTCTGTGCTGATCCACAAGCCACATGGGTGAGAGACGTGGTCAGGAGCATGGACAGGAAATCCAACACCAGAAATAACATGATCCAGACCAAGCCAACAGGAACCCAGCAATCGACCAATACAGCTGTGACTCTGACTGGCTAG |
ORF Protein Sequence | MRLLILALLGICSLTAYIVEGVGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-SE1386-Ab | Anti-XCL1/ ATAC/ LPTN functional antibody |
Target Antigen | GM-Tg-g-SE1386-Ag | XCL1 protein |
Cytokine | cks-Tg-g-GM-SE1386 | chemokine (C motif) ligand 1 (XCL1) protein & antibody |
ORF Viral Vector | pGMLP000163 | Human XCL1 Lentivirus plasmid |
ORF Viral Vector | vGMLP000163 | Human XCL1 Lentivirus particle |
Target information
Target ID | GM-SE1386 |
Target Name | XCL1 |
Gene ID | 6375, 100057696 |
Gene Symbol and Synonyms | ATAC,LPTN,LTN,SCM-1,SCM-1a,SCM1,SCM1A,SCYC1,XCL1 |
Uniprot Accession | P47992 |
Uniprot Entry Name | XCL1_HUMAN |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Cytokine Target |
Disease | Not Available |
Gene Ensembl | ENSG00000143184 |
Target Classification | Not Available |
This antimicrobial gene encodes a member of the chemokine superfamily. Chemokines function in inflammatory and immunological responses, inducing leukocyte migration and activation. The encoded protein is a member of the C-chemokine subfamily, retaining only two of four cysteines conserved in other chemokines, and is thought to be specifically chemotactic for T cells. This gene and a closely related family member are located on the long arm of chromosome 1. [provided by RefSeq, Sep 2014]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.