Human LACRT ORF/cDNA clone-Lentivirus plasmid (NM_033277.1)

Cat. No.: pGMLP000148
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human LACRT/ Lentiviral expression plasmid for LACRT lentivirus packaging, LACRT lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to LACRT/ products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000148
Gene Name LACRT
Accession Number NM_033277.1
Gene ID 90070
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 417 bp
Gene Alias
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAAATTTACCACTCTCCTCTTCTTGGCAGCTGTAGCAGGGGCCCTGGTCTATGCTGAAGATGCCTCCTCTGACTCGACGGGTGCTGATCCTGCCCAGGAAGCTGGGACCTCTAAGCCTAATGAAGAGATCTCAGGTCCAGCAGAACCAGCTTCACCCCCAGAGACAACCACAACAGCCCAGGAGACTTCGGCGGCAGCAGTTCAGGGGACAGCCAAGGTCACCTCAAGCAGGCAGGAACTAAACCCCCTGAAATCCATAGTGGAGAAAAGTATCTTACTAACAGAACAAGCCCTTGCAAAAGCAGGAAAAGGAATGCACGGAGGCGTGCCAGGTGGAAAACAATTCATCGAAAATGGAAGTGAATTTGCACAAAAATTACTGAAGAAATTCAGTCTATTAAAACCATGGGCATGA
ORF Protein Sequence MKFTTLLFLAAVAGALVYAEDASSDSTGADPAQEAGTSKPNEEISGPAEPASPPETTTTAQETSAAAVQGTAKVTSSRQELNPLKSIVEKSILLTEQALAKAGKGMHGGVPGGKQFIENGSEFAQKLLKKFSLLKPWA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1055-Ab Anti-LACRT functional antibody
    Target Antigen GM-Tg-g-SE1055-Ag LACRT protein
    ORF Viral Vector pGMLP000148 Human LACRT Lentivirus plasmid
    ORF Viral Vector vGMLP000148 Human LACRT Lentivirus particle


    Target information

    Target ID GM-SE1055
    Target Name LACRT
    Gene ID 90070, 654418, 102901478, 100687562
    Gene Symbol and Synonyms LACRT
    Uniprot Accession Q9GZZ8
    Uniprot Entry Name LACRT_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000135413
    Target Classification Not Available

    The protein encoded by this gene is highly expressed in the lacrimal glands and localized primarily to secretory granules and secretory fluid. It augments lacrimal acinar cell secretion, promotes ductal cell proliferation, and stimulates signaling through tyrosine phosphorylation and release of calcium. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.