Human EMP1/CL-20/EMP-1 ORF/cDNA clone-Lentivirus plasmid (NM_001423)

Cat. No.: pGMLP000009
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human EMP1/CL-20/EMP-1 Lentiviral expression plasmid for EMP1 lentivirus packaging, EMP1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to EMP1/CL-20 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000009
Gene Name EMP1
Accession Number NM_001423
Gene ID 2012
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 474 bp
Gene Alias CL-20,EMP-1,TMP
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTTGGTATTGCTGGCTGGTATCTTTGTGGTCCACATCGCTACTGTTATTATGCTATTTGTTAGCACCATTGCCAATGTCTGGTTGGTTTCCAATACGGTAGATGCATCAGTAGGTCTTTGGAAAAACTGTACCAACATTAGCTGCAGTGACAGCCTGTCATATGCCAGTGAAGATGCCCTCAAGACAGTGCAGGCCTTCATGATTCTCTCTATCATCTTCTGTGTCATTGCCCTCCTGGTCTTCGTGTTCCAGCTCTTCACCATGGAGAAGGGAAACCGGTTCTTCCTCTCAGGGGCCACCACACTGGTGTGCTGGCTGTGCATTCTTGTGGGGGTGTCCATCTACACTAGTCATTATGCGAATCGTGATGGAACGCAGTATCACCACGGCTATTCCTACATCCTGGGCTGGATCTGCTTCTGCTTCAGCTTCATCATCGGCGTTCTCTATCTGGTCCTGAGAAAGAAATAA
ORF Protein Sequence MLVLLAGIFVVHIATVIMLFVSTIANVWLVSNTVDASVGLWKNCTNISCSDSLSYASEDALKTVQAFMILSIIFCVIALLVFVFQLFTMEKGNRFFLSGATTLVCWLCILVGVSIYTSHYANRDGTQYHHGYSYILGWICFCFSFIIGVLYLVLRKK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0403-Ab Anti-EMP1/ CL-20/ EMP-1 monoclonal antibody
    Target Antigen GM-Tg-g-MP0403-Ag EMP1 VLP (virus-like particle)
    ORF Viral Vector pGMLP000009 Human EMP1 Lentivirus plasmid
    ORF Viral Vector vGMLP000009 Human EMP1 Lentivirus particle


    Target information

    Target ID GM-MP0403
    Target Name EMP1
    Gene ID 2012, 13730, 698319, 25314, 101094110, 486676, 786490, 100063668
    Gene Symbol and Synonyms CL-20,EMP-1,EMP1,ENP1MR,I-8-09,TMP
    Uniprot Accession P54849
    Uniprot Entry Name EMP1_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000134531
    Target Classification Not Available

    Involved in bleb assembly and cell death. Located in plasma membrane. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.