Human JUN/AP1/c-Jun ORF/cDNA clone-Adenovirus plasmid (BC006175)

Cat. No.: pGMAP000535
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human JUN/AP1/c-Jun adenoviral expression plasmid for JUN adenovirus packaging, JUN adenovirus.

Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.


Target products collection

Go to JUN/AP1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAP000535
Gene Name JUN
Accession Number BC006175
Gene ID 3725
Species Human
Product Type Adenovirus plasmid (overexpression)
Insert Length 996 bp
Gene Alias AP1,c-Jun
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence ATGACTGCAAAGATGGAAACGACCTTCTATGACGATGCCCTCAACGCCTCGTTCCTCCCGTCCGAGAGCGGACCTTATGGCTACAGTAACCCCAAGATCCTGAAACAGAGCATGACCCTGAACCTGGCCGACCCAGTGGGGAGCCTGAAGCCGCACCTCCGCGCCAAGAACTCGGACCTCCTCACCTCGCCCGACGTGGGGCTGCTCAAGCTGGCGTCGCCCGAGCTGGAGCGCCTGATAATCCAGTCCAGCAACGGGCACATCACCACCACGCCGACCCCCACCCAGTTCCTGTGCCCCAAGAACGTGACAGATGAGCAGGAGGGCTTCGCCGAGGGCTTCGTGCGCGCCCTGGCCGAACTGCACAGCCAGAACACGCTGCCCAGCGTCACGTCGGCGGCGCAGCCGGTCAACGGGGCAGGCATGGTGGCTCCCGCGGTAGCCTCGGTGGCAGGGGGCAGCGGCAGCGGCGGCTTCAGCGCCAGCCTGCACAGCGAGCCGCCGGTCTACGCAAACCTCAGCAACTTCAACCCAGGCGCGCTGAGCAGCGGCGGCGGGGCGCCCTCCTACGGCGCGGCCGGCCTGGCCTTTCCCGCGCAACCCCAGCAGCAGCAGCAGCCGCCGCACCACCTGCCCCAGCAGATGCCCGTGCAGCACCCGCGGCTGCAGGCCCTGAAGGAGGAGCCTCAGACAGTGCCCGAGATGCCCGGCGAGACACCGCCCCTGTCCCCCATCGACATGGAGTCCCAGGAGCGGATCAAGGCGGAGAGGAAGCGCATGAGGAACCGCATCGCTGCCTCCAAGTGCCGAAAAAGGAAGCTGGAGAGAATCGCCCGGCTGGAGGAAAAAGTGAAAACCTTGAAAGCTCAGAACTCGGAGCTGGCGTCCACGGCCAACATGCTCAGGGAACAGGTGGCACAGCTTAAACAGAAAGTCATGAACCACGTTAACAGTGGGTGCCAACTCATGCTAACGCAGCAGTTGCAAACATTTTGA
ORF Protein Sequence MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T69085-Ab Anti-JUN monoclonal antibody
    Target Antigen GM-Tg-g-T69085-Ag JUN protein
    ORF Viral Vector pGMLP005587 Human JUN Lentivirus plasmid
    ORF Viral Vector pGMLV000295 Human JUN Lentivirus plasmid
    ORF Viral Vector pGMLV001471 Human JUN Lentivirus plasmid
    ORF Viral Vector pGMAD000140 Human JUN Adenovirus plasmid
    ORF Viral Vector pGMAD000912 Human JUN Adenovirus plasmid
    ORF Viral Vector pGMAD001483 Human JUN Adenovirus plasmid
    ORF Viral Vector pGMAP000535 Human JUN Adenovirus plasmid
    ORF Viral Vector pGMLP-SPh-129 Human JUN Lentivirus plasmid
    ORF Viral Vector pGMAP-SPh-269 Human JUN Adenovirus plasmid
    ORF Viral Vector pGMPC000142 Human JUN Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP005587 Human JUN Lentivirus particle
    ORF Viral Vector vGMLV000295 Human JUN Lentivirus particle
    ORF Viral Vector vGMLV001471 Human JUN Lentivirus particle
    ORF Viral Vector vGMAD000140 Human JUN Adenovirus particle
    ORF Viral Vector vGMAD000912 Human JUN Adenovirus particle
    ORF Viral Vector vGMAD001483 Human JUN Adenovirus particle
    ORF Viral Vector vGMAP000535 Human JUN Adenovirus particle
    ORF Viral Vector vGMLP-SPh-129 Human JUN Lentivirus particle
    ORF Viral Vector vGMAP-SPh-269 Human JUN Adenovirus particle


    Target information

    Target ID GM-T69085
    Target Name JUN
    Gene ID 3725, 16476, 716452, 24516, 101097261, 609429, 280831, 100067469
    Gene Symbol and Synonyms AP-1,AP1,c-Jun,cJUN,JUN,Junc,p39
    Uniprot Accession P05412
    Uniprot Entry Name JUN_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Cancer
    Gene Ensembl ENSG00000177606
    Target Classification Tumor-associated antigen (TAA)

    This gene is the putative transforming gene of avian sarcoma virus 17. It encodes a protein which is highly similar to the viral protein, and which interacts directly with specific target DNA sequences to regulate gene expression. This gene is intronless and is mapped to 1p32-p31, a chromosomal region involved in both translocations and deletions in human malignancies. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.