Human RETN/ADSF/FIZZ3 ORF/cDNA clone-Adenovirus plasmid (BC069302)

Cat. No.: pGMAP000284
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human RETN/ADSF/FIZZ3 adenoviral expression plasmid for RETN adenovirus packaging, RETN adenovirus.

Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.


Target products collection

Go to RETN/ADSF products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAP000284
Gene Name RETN
Accession Number BC069302
Gene ID 56729
Species Human
Product Type Adenovirus plasmid (overexpression)
Insert Length 327 bp
Gene Alias ADSF,FIZZ3,RETN1,RSTN,XCP1
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Kanamycin
ORF Nucleotide Sequence ATGAAAGCTCTCTGTCTCCTCCTCCTCCCTGTCCTGGGGCTGTTGGTGTCTAGCAAGACCCTGTGCTCCATGGAAGAAGCCATCAATGAGAGGATCCAGGAGGTCGCCGGCTCCCTAATATTTAGGGCAATAAGCAGCATTGGCCTGGAGTGCCAGAGCGTCACCTCCAGGGGGGACCTGGCTACTTGCCCCCGAGGCTTCGCCGTCACCGGCTGCACTTGTGGCTCCGCCTGTGGCTCGTGGGATGTGCGCGCCGAGACCACATGTCACTGCCAGTGCGCGGGCATGGACTGGACCGGAGCGCGCTGCTGTCGTGTGCAGCCCTGA
ORF Protein Sequence MKALCLLLLPVLGLLVSSKTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1239-Ab Anti-RETN/ ADSF/ FIZZ31 functional antibody
    Target Antigen GM-Tg-g-SE1239-Ag RETN protein
    Cytokine cks-Tg-g-GM-SE1239 resistin (RETN) protein & antibody
    ORF Viral Vector pGMLP001996 Human RETN Lentivirus plasmid
    ORF Viral Vector pGMAP000284 Human RETN Adenovirus plasmid
    ORF Viral Vector vGMLP001996 Human RETN Lentivirus particle
    ORF Viral Vector vGMAP000284 Human RETN Adenovirus particle


    Target information

    Target ID GM-SE1239
    Target Name RETN
    Gene ID 56729, 57264, 708781, 246250, 100142685, 611540, 369020, 100060741
    Gene Symbol and Synonyms ADSF,FIZZ3,RENT,RETN,RETN1,RSTN,XCP1,Xcp4
    Uniprot Accession Q9HD89
    Uniprot Entry Name RETN_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Cytokine Target
    Disease Sepsis, Malignant neoplasm of bladder
    Gene Ensembl ENSG00000104918
    Target Classification Not Available

    This gene belongs to the family defined by the mouse resistin-like genes. The characteristic feature of this family is the C-terminal stretch of 10 cys residues with identical spacing. The mouse homolog of this protein is secreted by adipocytes, and may be the hormone potentially linking obesity to type II diabetes. The encoded protein also has an antimicrobial role in skin, displaying antibacterial activity against both Gram positive and Gram negative bacteria. Alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2020]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.