Human PDGFRA/CD140A/PDGFR2 ORF/cDNA clone-Adenovirus plasmid (BC015186)

Cat. No.: pGMAP000154
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human PDGFRA/CD140A/PDGFR2 adenoviral expression plasmid for PDGFRA adenovirus packaging, PDGFRA adenovirus.

Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.


Target products collection

Go to PDGFRA/CD140A products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAP000154
Gene Name PDGFRA
Accession Number BC015186
Gene ID 5156
Species Human
Product Type Adenovirus plasmid (overexpression)
Insert Length 657 bp
Gene Alias CD140A,PDGFR2
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Kanamycin
ORF Nucleotide Sequence ATGGGGACTTCCCATCCGGCGTTCCTGGTCTTAGGCTGTCTTCTCACAGGGCTGAGCCTAATCCTCTGCCAGCTTTCATTACCCTCTATCCTTCCAAATGAAAATGAAAAGGTTGTGCAGCTGAATTCATCCTTTTCTCTGAGATGCTTTGGGGAGAGTGAAGTGAGCTGGCAGTACCCCATGTCTGAAGAAGAGAGCTCCGATGTGGAAATCAGAAATGAAGAAAACAACAGCGGCCTTTTTGTGACGGTCTTGGAAGTGAGCAGTGCCTCGGCGGCCCACACAGGGTTGTACACTTGCTATTACAACCACACTCAGACAGAAGAGAATGAGCTTGAAGGCAGGCACATTTACATCTATGTGCCAGACCCAGATGTAGCCTTTGTACCTCTAGGAATGACGGATTATTTAGTCATCGTGGAGGATGATGATTCTGCCATTATACCTTGTCGCACAACTGATCCCGAGACTCCTGTAACCTTACACAACAGTGAGGGGGTGGTACCTGCCTCCTACGACAGCAGACAGGGCTTTAATGGGACCTTCACTGTAGGGCCCTATATCTGTGAGGCCACCGTCAAAGGAAAGAAGTTCCAGACCATCCCATTTAATGTTTATGCTTTAAAAGGTACTTGTATCATCTCCTTCCTTCTTTAA
ORF Protein Sequence MGTSHPAFLVLGCLLTGLSLILCQLSLPSILPNENEKVVQLNSSFSLRCFGESEVSWQYPMSEEESSDVEIRNEENNSGLFVTVLEVSSASAAHTGLYTCYYNHTQTEENELEGRHIYIYVPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLHNSEGVVPASYDSRQGFNGTFTVGPYICEATVKGKKFQTIPFNVYALKGTCIISFLL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-ab-393 Pre-Made Olaratumab biosimilar, Whole mAb, Anti-PDGFRA Antibody: Anti-CD140A/PDGFR-2/PDGFR2 therapeutic antibody
    Biosimilar GMP-Bios-ab-590 Pre-Made Tovetumab biosimilar, Whole mAb, Anti-PDGFRA Antibody: Anti-CD140A/PDGFR-2/PDGFR2 therapeutic antibody
    Target Antibody GM-Tg-g-T53524-Ab Anti-PGFRA/ PDGFRA/ CD140A monoclonal antibody
    Target Antigen GM-Tg-g-T53524-Ag PDGFRA VLP (virus-like particle)
    Cytokine cks-Tg-g-GM-T53524 Platelet-derived growth factor receptors (PDGF-R) are cell surface tyrosine kinase receptors for members of theplatelet-derived growth factor (PDGF) family. PDGF subunits -A and -B are important factors regulating cell proliferation, cellular differentiat (PDGFRA) protein & antibody
    ORF Viral Vector pGMLP005737 Human PDGFRA Lentivirus plasmid
    ORF Viral Vector pGMAP000154 Human PDGFRA Adenovirus plasmid
    ORF Viral Vector vGMLP005737 Human PDGFRA Lentivirus particle
    ORF Viral Vector vGMAP000154 Human PDGFRA Adenovirus particle


    Target information

    Target ID GM-T53524
    Target Name PDGFRA
    Gene ID 5156, 18595, 697002, 25267, 101090765, 442860, 282301, 100059815
    Gene Symbol and Synonyms APDGFR,CD140A,PDGFACE,PDGFR-2,PDGFR2,PDGFRA
    Uniprot Accession P16234
    Uniprot Entry Name PGFRA_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, INN Index, Cytokine Target
    Disease Non-Small Cell Lung Cancer
    Gene Ensembl ENSG00000134853
    Target Classification Not Available

    This gene encodes a cell surface tyrosine kinase receptor for members of the platelet-derived growth factor family. These growth factors are mitogens for cells of mesenchymal origin. The identity of the growth factor bound to a receptor monomer determines whether the functional receptor is a homodimer or a heterodimer, composed of both platelet-derived growth factor receptor alpha and beta polypeptides. Studies suggest that this gene plays a role in organ development, wound healing, and tumor progression. Mutations in this gene have been associated with idiopathic hypereosinophilic syndrome, somatic and familial gastrointestinal stromal tumors, and a variety of other cancers. [provided by RefSeq, Mar 2012]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.