Human IL36RN/FIL1/FIL1(DELTA) ORF/cDNA clone-Adenovirus plasmid (NM_012275)

Cat. No.: pGMAP-IL-125
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human IL36RN/FIL1/FIL1(DELTA) adenoviral expression plasmid for IL36RN adenovirus packaging, IL36RN adenovirus.

Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.


Target products collection

Go to IL36RN/FIL1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAP-IL-125
Gene Name IL36RN
Accession Number NM_012275
Gene ID 26525
Species Human
Product Type Adenovirus plasmid (overexpression)
Insert Length 468 bp
Gene Alias FIL1,FIL1(DELTA),FIL1D,IL-36Ra,IL1F5,IL1HY1,IL1L1,IL1RP3,IL36RA,PSORP,PSORS14
Fluorescent Reporter EGFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Kanamycin
ORF Nucleotide Sequence ATGGTCCTGAGTGGGGCGCTGTGCTTCCGAATGAAGGACTCGGCATTGAAGGTGCTTTATCTGCATAATAACCAGCTTCTAGCTGGAGGGCTGCATGCAGGGAAGGTCATTAAAGGTGAAGAGATCAGCGTGGTCCCCAATCGGTGGCTGGATGCCAGCCTGTCCCCCGTCATCCTGGGTGTCCAGGGTGGAAGCCAGTGCCTGTCATGTGGGGTGGGGCAGGAGCCGACTCTAACACTAGAGCCAGTGAACATCATGGAGCTCTATCTTGGTGCCAAGGAATCCAAGAGCTTCACCTTCTACCGGCGGGACATGGGGCTCACCTCCAGCTTCGAGTCGGCTGCCTACCCGGGCTGGTTCCTGTGCACGGTGCCTGAAGCCGATCAGCCTGTCAGACTCACCCAGCTTCCCGAGAATGGTGGCTGGAATGCCCCCATCACAGACTTCTACTTCCAGCAGTGTGACTAG
ORF Protein Sequence MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-ab-532 Pre-Made Spesolimab biosimilar, Whole mAb, Anti-IL36RN/IL-36R Antibody: Anti-FIL1/FIL1(DELTA)/FIL1D/IL1F5/IL1HY1/IL1L1/IL1RP3/IL36RA/PSORP/PSORS14 therapeutic antibody
    Target Antibody GM-Tg-g-SE0627-Ab Anti-I36RA/ IL36RN/ FIL1 functional antibody
    Target Antigen GM-Tg-g-SE0627-Ag IL36RN protein
    Cytokine cks-Tg-g-GM-SE0627 interleukin 36 receptor antagonist (IL36RN) protein & antibody
    ORF Viral Vector pGMLP004790 Human IL36RN Lentivirus plasmid
    ORF Viral Vector pGMLP-IL-042 Human IL36RN Lentivirus plasmid
    ORF Viral Vector pGMAP-IL-125 Human IL36RN Adenovirus plasmid
    ORF Viral Vector vGMLP004790 Human IL36RN Lentivirus particle
    ORF Viral Vector vGMLP-IL-042 Human IL36RN Lentivirus particle
    ORF Viral Vector vGMAP-IL-125 Human IL36RN Adenovirus particle


    Target information

    Target ID GM-SE0627
    Target Name IL36RN
    Gene ID 26525, 54450, 705268, 311783, 611869, 518514, 100065154
    Gene Symbol and Synonyms FIL1,FIL1(DELTA),FIL1D,Fil1delta,If36rn,Il-1h3,IL-36Ra,IL1F5,IL1HY1,IL1L1,IL1RP3,IL36RA,IL36RN,PSORP,PSORS14
    Uniprot Accession Q9UBH0
    Uniprot Entry Name I36RA_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, INN Index, Cytokine Target
    Disease Not Available
    Gene Ensembl ENSG00000136695
    Target Classification Not Available

    The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine was shown to specifically inhibit the activation of NF-kappaB induced by interleukin 1 family, member 6 (IL1F6). This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. Two alternatively spliced transcript variants encoding the same protein have been reported. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.