Human PTN/HARP/HB-GAM ORF/cDNA clone-Adenovirus plasmid (NM_002825.7)

Cat. No.: pGMAD001512
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human PTN/HARP/HB-GAM adenoviral expression plasmid for PTN adenovirus packaging, PTN adenovirus.

Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to PTN/HARP products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAD001512
Gene Name PTN
Accession Number NM_002825.7
Gene ID 5764
Species Human
Product Type Adenovirus plasmid (overexpression)
Insert Length 507 bp
Gene Alias HARP,HB-GAM,HBBM,HBGF-8,HBGF8,HBNF,HBNF-1,NEGF1,OSF-1
Fluorescent Reporter EGFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Kanamycin
ORF Nucleotide Sequence ATGCAGGCTCAACAGTACCAGCAGCAGCGTCGAAAATTTGCAGCTGCCTTCTTGGCATTCATTTTCATACTGGCAGCTGTGGATACTGCTGAAGCAGGGAAGAAAGAGAAACCAGAAAAAAAAGTGAAGAAGTCTGACTGTGGAGAATGGCAGTGGAGTGTGTGTGTGCCCACCAGTGGAGACTGTGGGCTGGGCACACGGGAGGGCACTCGGACTGGAGCTGAGTGCAAGCAAACCATGAAGACCCAGAGATGTAAGATCCCCTGCAACTGGAAGAAGCAATTTGGCGCGGAGTGCAAATACCAGTTCCAGGCCTGGGGAGAATGTGACCTGAACACAGCCCTGAAGACCAGAACTGGAAGTCTGAAGCGAGCCCTGCACAATGCCGAATGCCAGAAGACTGTCACCATCTCCAAGCCCTGTGGCAAACTGACCAAGCCCAAACCTCAAGCAGAATCTAAGAAGAAGAAAAAGGAAGGCAAGAAACAGGAGAAGATGCTGGATTAA
ORF Protein Sequence MQAQQYQQQRRKFAAAFLAFIFILAAVDTAEAGKKEKPEKKVKKSDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLD

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T49522-Ab Anti-PTN/ HARP/ HB-GAM monoclonal antibody
    Target Antigen GM-Tg-g-T49522-Ag PTN VLP (virus-like particle)
    ORF Viral Vector pGMLP000869 Human PTN Lentivirus plasmid
    ORF Viral Vector pGMAD001512 Human PTN Adenovirus plasmid
    ORF Viral Vector vGMLP000869 Human PTN Lentivirus particle
    ORF Viral Vector vGMAD001512 Human PTN Adenovirus particle


    Target information

    Target ID GM-T49522
    Target Name PTN
    Gene ID 5764, 19242, 709496, 24924, 101100041, 475509, 280904, 100064880
    Gene Symbol and Synonyms HARP,HB-GAM,HBBM,HBBN,HBGF-8,HBGF8,HBNF,HBNF-1,NEGF1,OSF,OSF-1,Osf1,PTN
    Uniprot Accession P21246
    Uniprot Entry Name PTN_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease Lung Cancer
    Gene Ensembl ENSG00000105894
    Target Classification Not Available

    The protein encoded by this gene is a secreted heparin-binding growth factor. The protein has significant roles in cell growth and survival, cell migration, angiogenesis and tumorigenesis. Alternative splicing and the use of alternative promoters results in multiple transcript variants. [provided by RefSeq, Oct 2016]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.