Human PTN/HARP/HB-GAM ORF/cDNA clone-Adenovirus plasmid (NM_002825.7)
Cat. No.: pGMAD001512
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human PTN/HARP/HB-GAM adenoviral expression plasmid for PTN adenovirus packaging, PTN adenovirus.
Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.
Go to
PTN/HARP products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMAD001512 |
Gene Name | PTN |
Accession Number | NM_002825.7 |
Gene ID | 5764 |
Species | Human |
Product Type | Adenovirus plasmid (overexpression) |
Insert Length | 507 bp |
Gene Alias | HARP,HB-GAM,HBBM,HBGF-8,HBGF8,HBNF,HBNF-1,NEGF1,OSF-1 |
Fluorescent Reporter | EGFP |
Mammalian Cell Selection | Null |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Kanamycin |
ORF Nucleotide Sequence | ATGCAGGCTCAACAGTACCAGCAGCAGCGTCGAAAATTTGCAGCTGCCTTCTTGGCATTCATTTTCATACTGGCAGCTGTGGATACTGCTGAAGCAGGGAAGAAAGAGAAACCAGAAAAAAAAGTGAAGAAGTCTGACTGTGGAGAATGGCAGTGGAGTGTGTGTGTGCCCACCAGTGGAGACTGTGGGCTGGGCACACGGGAGGGCACTCGGACTGGAGCTGAGTGCAAGCAAACCATGAAGACCCAGAGATGTAAGATCCCCTGCAACTGGAAGAAGCAATTTGGCGCGGAGTGCAAATACCAGTTCCAGGCCTGGGGAGAATGTGACCTGAACACAGCCCTGAAGACCAGAACTGGAAGTCTGAAGCGAGCCCTGCACAATGCCGAATGCCAGAAGACTGTCACCATCTCCAAGCCCTGTGGCAAACTGACCAAGCCCAAACCTCAAGCAGAATCTAAGAAGAAGAAAAAGGAAGGCAAGAAACAGGAGAAGATGCTGGATTAA |
ORF Protein Sequence | MQAQQYQQQRRKFAAAFLAFIFILAAVDTAEAGKKEKPEKKVKKSDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLD |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T49522-Ab | Anti-PTN/ HARP/ HB-GAM monoclonal antibody |
Target Antigen | GM-Tg-g-T49522-Ag | PTN VLP (virus-like particle) |
ORF Viral Vector | pGMLP000869 | Human PTN Lentivirus plasmid |
ORF Viral Vector | pGMAD001512 | Human PTN Adenovirus plasmid |
ORF Viral Vector | vGMLP000869 | Human PTN Lentivirus particle |
ORF Viral Vector | vGMAD001512 | Human PTN Adenovirus particle |
Target information
Target ID | GM-T49522 |
Target Name | PTN |
Gene ID | 5764, 19242, 709496, 24924, 101100041, 475509, 280904, 100064880 |
Gene Symbol and Synonyms | HARP,HB-GAM,HBBM,HBBN,HBGF-8,HBGF8,HBNF,HBNF-1,NEGF1,OSF,OSF-1,Osf1,PTN |
Uniprot Accession | P21246 |
Uniprot Entry Name | PTN_HUMAN |
Protein Sub-location | Transmembrane Protein |
Category | Therapeutics Target |
Disease | Lung Cancer |
Gene Ensembl | ENSG00000105894 |
Target Classification | Not Available |
The protein encoded by this gene is a secreted heparin-binding growth factor. The protein has significant roles in cell growth and survival, cell migration, angiogenesis and tumorigenesis. Alternative splicing and the use of alternative promoters results in multiple transcript variants. [provided by RefSeq, Oct 2016]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.