Human GPX4/GPx-4/GSHPx-4 ORF/cDNA clone-Adeno-associate virus(AAV) plasmid (NM_002085.5)

Cat. No.: pGMAAV001492
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human GPX4/GPx-4/GSHPx-4 Adeno-associated virus expression plasmid (ITR-vector) for GPX4 AAV packaging, GPX4 AAV production.The purified Human GPX4/GPx-4/GSHPx-4 AAV particle serves as an invaluable asset for in-depth in vivo GPX4 studies, mechanism of action (MOA) research, and the evolution of GPX4-associated gene therapy strategies.

Our GM-AAV ITR vector is optimized with the G-NEXT™ multi-serotypes AAV vector system. Explore the G-NEXT™ system in detail.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to GPX4/GPx-4 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAAV001492
Gene Name GPX4
Accession Number NM_002085.5
Gene ID 2879
Species Human
Product Type Adeno-associate virus(AAV) plasmid (overexpression)
Insert Length 594 bp
Gene Alias GPx-4,GSHPx-4,MCSP,PHGPx,SMDS,snGPx,snPHGPx
Fluorescent Reporter Null
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter CTNT
Resistance Amplicin
ORF Nucleotide Sequence ATGAGCCTCGGCCGCCTTTGCCGCCTACTGAAGCCGGCGCTGCTCTGTGGGGCTCTGGCCGCGCCTGGCCTGGCCGGGACCATGTGCGCGTCCCGGGACGACTGGCGCTGTGCGCGCTCCATGCACGAGTTTTCCGCCAAGGACATCGACGGGCACATGGTTAACCTGGACAAGTACCGGGGCTTCGTGTGCATCGTCACCAACGTGGCCTCCCAGTGAGGCAAGACCGAAGTAAACTACACTCAGCTCGTCGACCTGCACGCCCGATACGCTGAGTGTGGTTTGCGGATCCTGGCCTTCCCGTGTAACCAGTTCGGGAAGCAGGAGCCAGGGAGTAACGAAGAGATCAAAGAGTTCGCCGCGGGCTACAACGTCAAATTCGATATGTTCAGCAAGATCTGCGTGAACGGGGACGACGCCCACCCGCTGTGGAAGTGGATGAAGATCCAACCCAAGGGCAAGGGCATCCTGGGAAATGCCATCAAGTGGAACTTCACCAAGTTCCTCATCGACAAGAACGGCTGCGTGGTGAAGCGCTACGGACCCATGGAGGAGCCCCTGGTGATAGAGAAGGACCTGCCCCACTATTTCTAG
ORF Protein Sequence MSLGRLCRLLKPALLCGALAAPGLAGTMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1581-Ab Anti-GPX4/ GPx-4/ GSHPx-4 functional antibody
    Target Antigen GM-Tg-g-SE1581-Ag GPX4 protein
    ORF Viral Vector pGMLP003326 Human GPX4 Lentivirus plasmid
    ORF Viral Vector pGMLV001745 Human GPX4 Lentivirus plasmid
    ORF Viral Vector pGMAAV001492 Human GPX4 Adeno-associate virus(AAV) plasmid
    ORF Viral Vector pGMPC000647 Human GPX4 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector pGMPC001494 Human GPX4 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP003326 Human GPX4 Lentivirus particle
    ORF Viral Vector vGMLV001745 Human GPX4 Lentivirus particle
    ORF Viral Vector vGMAAV001492 Human GPX4 Adeno-associate virus(AAV) particle


    Target information

    Target ID GM-SE1581
    Target Name GPX4
    Gene ID 2879, 625249, 705333, 29328, 101095956, 119864793, 286809, 102147383
    Gene Symbol and Synonyms GPx-4,GPX4,GSHPx-4,MCSP,mtPHGPx,PHGPx,SMDS,snGPx,snPHGPx
    Uniprot Accession P36969
    Uniprot Entry Name GPX4_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000167468
    Target Classification Not Available

    The protein encoded by this gene belongs to the glutathione peroxidase family, members of which catalyze the reduction of hydrogen peroxide, organic hydroperoxides and lipid hydroperoxides, and thereby protect cells against oxidative damage. Several isozymes of this gene family exist in vertebrates, which vary in cellular location and substrate specificity. This isozyme has a high preference for lipid hydroperoxides and protects cells against membrane lipid peroxidation and cell death. It is also required for normal sperm development; thus, it has been identified as a 'moonlighting' protein because of its ability to serve dual functions as a peroxidase, as well as a structural protein in mature spermatozoa. Mutations in this gene are associated with Sedaghatian type of spondylometaphyseal dysplasia (SMDS). This isozyme is also a selenoprotein, containing the rare amino acid selenocysteine (Sec) at its active site. Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. Transcript variants resulting from alternative splicing or use of alternate promoters have been described to encode isoforms with different subcellular localization. [provided by RefSeq, Dec 2018]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.