Human TNFSF15/TL1/TL1A ORF/cDNA clone-Adeno-associate virus(AAV) plasmid (NM_005118)
Cat. No.: pGMAAV000281
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human TNFSF15/TL1/TL1A Adeno-associated virus expression plasmid (ITR-vector) for TNFSF15 AAV packaging, TNFSF15 AAV production.The purified Human TNFSF15/TL1/TL1A AAV particle serves as an invaluable asset for in-depth in vivo TNFSF15 studies, mechanism of action (MOA) research, and the evolution of TNFSF15-associated gene therapy strategies.
Our GM-AAV ITR vector is optimized with the G-NEXT™ multi-serotypes AAV vector system. Explore the G-NEXT™ system in detail.
Go to
TNFSF15/TL1 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMAAV000281 |
Gene Name | TNFSF15 |
Accession Number | NM_005118 |
Gene ID | 9966 |
Species | Human |
Product Type | Adeno-associate virus(AAV) plasmid (overexpression) |
Insert Length | 756 bp |
Gene Alias | TL1,TL1A,TNLG1B,VEGI,VEGI192A |
Fluorescent Reporter | GFP |
Mammalian Cell Selection | Null |
Fusion Tag | Null |
Promoter | TBG |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGCCGAGGATCTGGGACTGAGCTTTGGGGAAACAGCCAGTGTGGAAATGCTGCCAGAGCACGGCAGCTGCAGGCCCAAGGCCAGGAGCAGCAGCGCACGCTGGGCTCTCACCTGCTGCCTGGTGTTGCTCCCCTTCCTTGCAGGACTCACCACATACCTGCTTGTCAGCCAGCTCCGGGCCCAGGGAGAGGCCTGTGTGCAGTTCCAGGCTCTAAAAGGACAGGAGTTTGCACCTTCACATCAGCAAGTTTATGCACCTCTTAGAGCAGACGGAGATAAGCCAAGGGCACACCTGACAGTTGTGAGACAAACTCCCACACAGCACTTTAAAAATCAGTTCCCAGCTCTGCACTGGGAACATGAACTAGGCCTGGCCTTCACCAAGAACCGAATGAACTATACCAACAAATTCCTGCTGATCCCAGAGTCGGGAGACTACTTCATTTACTCCCAGGTCACATTCCGTGGGATGACCTCTGAGTGCAGTGAAATCAGACAAGCAGGCCGACCAAACAAGCCAGACTCCATCACTGTGGTCATCACCAAGGTAACAGACAGCTACCCTGAGCCAACCCAGCTCCTCATGGGGACCAAGTCTGTATGCGAAGTAGGTAGCAACTGGTTCCAGCCCATCTACCTCGGAGCCATGTTCTCCTTGCAAGAAGGGGACAAGCTAATGGTGAACGTCAGTGACATCTCTTTGGTGGATTACACAAAAGAAGATAAAACCTTCTTTGGAGCCTTCTTACTATAG |
ORF Protein Sequence | MAEDLGLSFGETASVEMLPEHGSCRPKARSSSARWALTCCLVLLPFLAGLTTYLLVSQLRAQGEACVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T35212-Ab | Anti-TNF15/ TNFSF15/ TL1 monoclonal antibody |
Target Antigen | GM-Tg-g-T35212-Ag | TNFSF15 VLP (virus-like particle) |
Cytokine | cks-Tg-g-GM-T35212 | Tumor necrosis factor superfamily member 15 (TNFSF15) protein & antibody |
ORF Viral Vector | pGMLP004530 | Human TNFSF15 Lentivirus plasmid |
ORF Viral Vector | pGMAAV000281 | Human TNFSF15 Adeno-associate virus(AAV) plasmid |
ORF Viral Vector | vGMLP004530 | Human TNFSF15 Lentivirus particle |
ORF Viral Vector | vGMAAV000281 | Human TNFSF15 Adeno-associate virus(AAV) particle |
Target information
Target ID | GM-T35212 |
Target Name | TNFSF15 |
Gene ID | 9966, 326623, 703189, 252878, 101099505, 481688, 514239, 100049906 |
Gene Symbol and Synonyms | TL1,TL1A,TNFSF15,TNLG1B,VEGI,VEGI192A |
Uniprot Accession | O95150 |
Uniprot Entry Name | TNF15_HUMAN |
Protein Sub-location | Transmembrane Protein |
Category | Therapeutics Target, Cytokine Target |
Disease | Not Available |
Gene Ensembl | ENSG00000181634 |
Target Classification | Not Available |
The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein is abundantly expressed in endothelial cells, but is not expressed in either B or T cells. The expression of this protein is inducible by TNF and IL-1 alpha. This cytokine is a ligand for receptor TNFRSF25 and decoy receptor TNFRSF21/DR6. It can activate NF-kappaB and MAP kinases, and acts as an autocrine factor to induce apoptosis in endothelial cells. This cytokine is also found to inhibit endothelial cell proliferation, and thus may function as an angiogenesis inhibitor. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2011]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.